GediPNet logo

ICOSLG (inducible T cell costimulator ligand)
Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23308
Gene nameGene Name - the full gene name approved by the HGNC.
Inducible T cell costimulator ligand
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
ICOSLG
SynonymsGene synonyms aliases
B7-H2, B7H2, B7RP-1, B7RP1, B7h, CD275, GL50, ICOS-L, ICOSL, IMD119, LICOS
ChromosomeChromosome number
21
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
SNPsSNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
SNP ID Visualize variation Clinical significance Consequence
rs1165558487 C>A,T Likely-pathogenic Intron variant, splice donor variant
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT039046 hsa-miR-766-3p CLASH 23622248
MIRT716789 hsa-miR-6769a-3p HITS-CLIP 19536157
MIRT716790 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT716788 hsa-miR-4459 HITS-CLIP 19536157
MIRT716787 hsa-miR-665 HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0001817 Process Regulation of cytokine production IBA 21873635
GO:0002250 Process Adaptive immune response IEA
GO:0005102 Function Signaling receptor binding IBA 21873635
GO:0005102 Function Signaling receptor binding TAS 11429535
GO:0005515 Function Protein binding IPI 11956294, 16951355
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O75144
Protein name ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)
Protein function Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion (PubMed:11007762, PubMed:11023515, PubMed:30498080). Also induces B-cell proliferation and differentiation
PDB 6X4G , 6X4T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set
20 → 133
Immunoglobulin V-set domain
 Domain
Sequence 
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
Sequence length 302
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
Reactome
  Cell adhesion molecules
Intestinal immune network for IgA production 		  Costimulation by the CD28 family
Associated diseases
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 21150878
Autoimmune diseases Autoimmune Diseases rs41285370, rs869025224 21383967
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544 22190364
Rheumatoid arthritis Rheumatoid Arthritis rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212 30423114, 24390342
Unknown
Disease name Disease term dbSNP ID References
Celiac disease Celiac Disease rs2305764, rs35218876 20190752
Immune system diseases Immune System Diseases 21383967
Ulcerative colitis Ulcerative Colitis 20228799

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412