GediPNet logo

FLI1 (Fli-1 proto-oncogene, ETS transcription factor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2313
Gene nameGene Name - the full gene name approved by the HGNC.
Fli-1 proto-oncogene, ETS transcription factor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
FLI1
SynonymsGene synonyms aliases
BDPLT21, EWSR2, FLI-1, SIC-1
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sar
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs773148506 C>A,T Pathogenic Missense variant, coding sequence variant, synonymous variant
rs1064797083 C>T Likely-pathogenic Missense variant, coding sequence variant
rs1064797084 A>G Pathogenic Missense variant, coding sequence variant
rs1064797085 ATTA>- Pathogenic, likely-pathogenic Coding sequence variant, frameshift variant
rs1064797086 G>A Pathogenic, likely-pathogenic Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004496 hsa-miR-145-5p qRT-PCR, Luciferase reporter assay, Western blot 20382729
MIRT005349 hsa-miR-155-5p Western blot 18950466
MIRT004496 hsa-miR-145-5p Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 20737575
MIRT004496 hsa-miR-145-5p Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 20737575
MIRT004496 hsa-miR-145-5p Luciferase reporter assay, Western blot 21217773
Transcription factors
Transcription factor Regulation Reference
ELF1 Activation 19829305
ETS1 Activation 19829305
ETS2 Activation 19829305
FLI1 Activation 19829305
GATA1 Unknown 10523830
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q01543
Protein name Friend leukemia integration 1 transcription factor (Proto-oncogene Fli-1) (Transcription factor ERGB)
Protein function Sequence-specific transcriptional activator (PubMed:24100448, PubMed:26316623, PubMed:28255014). Recognizes the DNA sequence 5'-C[CA]GGAAGT-3'.
PDB 1FLI , 1X66 , 2YTU , 5E8G , 5E8I , 5JVT , 6VG2 , 6VG8 , 6VGD , 9CP6 , 9MWY , 9MX8 , 9MX9 , 9MXA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02198 SAM_PNT
114 198
Sterile alpha motif (SAM)/Pointed domain
Domain
PF00178 Ets
282 361
Ets-domain
Domain
Sequence
MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT
LYNTEVLLSHLSYLRESS
LLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK
SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
D
FHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
Sequence length 452
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Transcriptional misregulation in cancer  
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs120074176, rs786205019
Bleeding disorder BLEEDING DISORDER, PLATELET-TYPE, 21 rs121918444, rs387906691, rs397514542, rs398122372, rs398122373, rs773148506, rs1064797083, rs1064797085, rs1064797087, rs761749948 28255014, 26316623, 24100448
Unknown
Disease name Disease term dbSNP ID References
Annular pancreas Annular pancreas
Anorexia Anorexia
Aortic coarctation Aortic coarctation
Aortic valve sclerosis Aortic Valve Stenosis

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412