KDM4C (lysine demethylase 4C)

Gene

• Entrez ID: 23081
• Gene name: Lysine demethylase 4C
• Gene symbol: KDM4C
• Synonyms: GASC1, JHDM3C, JMJD2C, TDRD14C
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016783	hsa-miR-335-5p	Microarray	18185580
MIRT440401	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440400	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT440401	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440400	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT1084581	hsa-miR-3689a-5p	CLIP-seq
MIRT1084582	hsa-miR-3689b	CLIP-seq
MIRT1084583	hsa-miR-3689e	CLIP-seq
MIRT1084584	hsa-miR-3689f	CLIP-seq
MIRT1084585	hsa-miR-4291	CLIP-seq
MIRT1084586	hsa-miR-545	CLIP-seq
MIRT1084587	hsa-miR-556-5p	CLIP-seq
MIRT737734	hsa-miR-4765	CLIP-seq
MIRT737735	hsa-miR-5096	CLIP-seq
MIRT1084588	hsa-miR-1178	CLIP-seq
MIRT1084589	hsa-miR-1324	CLIP-seq
MIRT1084590	hsa-miR-216a	CLIP-seq
MIRT1084591	hsa-miR-335	CLIP-seq
MIRT1084592	hsa-miR-3613-3p	CLIP-seq
MIRT1084593	hsa-miR-3686	CLIP-seq
MIRT1084594	hsa-miR-4272	CLIP-seq
MIRT1084595	hsa-miR-4277	CLIP-seq
MIRT1084596	hsa-miR-4282	CLIP-seq
MIRT1084597	hsa-miR-4457	CLIP-seq
MIRT1084598	hsa-miR-4495	CLIP-seq
MIRT1084599	hsa-miR-451b	CLIP-seq
MIRT1084600	hsa-miR-4696	CLIP-seq
MIRT1084601	hsa-miR-4719	CLIP-seq
MIRT1084602	hsa-miR-4753-5p	CLIP-seq
MIRT1084603	hsa-miR-513a-3p	CLIP-seq
MIRT1084604	hsa-miR-513b	CLIP-seq
MIRT1084605	hsa-miR-513c	CLIP-seq
MIRT1084606	hsa-miR-514b-5p	CLIP-seq
MIRT1084607	hsa-miR-548n	CLIP-seq
MIRT1084608	hsa-miR-548t	CLIP-seq
MIRT1084609	hsa-miR-579	CLIP-seq
MIRT1084610	hsa-miR-599	CLIP-seq
MIRT1084611	hsa-miR-602	CLIP-seq
MIRT1084612	hsa-miR-624	CLIP-seq
MIRT1084613	hsa-miR-767-3p	CLIP-seq
MIRT737734	hsa-miR-4765	CLIP-seq
MIRT737735	hsa-miR-5096	CLIP-seq
MIRT2442292	hsa-miR-4268	CLIP-seq
MIRT2442293	hsa-miR-4448	CLIP-seq
MIRT2442294	hsa-miR-4694-5p	CLIP-seq
MIRT2452337	hsa-miR-1236	CLIP-seq
MIRT2452338	hsa-miR-4768-5p	CLIP-seq
MIRT2452339	hsa-miR-942	CLIP-seq
MIRT2555923	hsa-miR-1281	CLIP-seq
MIRT2555924	hsa-miR-3144-5p	CLIP-seq
MIRT2555925	hsa-miR-3918	CLIP-seq
MIRT1084597	hsa-miR-4457	CLIP-seq
MIRT2555923	hsa-miR-1281	CLIP-seq
MIRT2555924	hsa-miR-3144-5p	CLIP-seq
MIRT2555925	hsa-miR-3918	CLIP-seq
MIRT1084597	hsa-miR-4457	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	17277772
GO:0003682	Function	Chromatin binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0006338	Process	Chromatin remodeling	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	17277772
GO:0008270	Function	Zinc ion binding	IDA	21914792
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	17277772
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019899	Function	Enzyme binding	IPI	17277772
GO:0032452	Function	Histone demethylase activity	EXP	18066052
GO:0032452	Function	Histone demethylase activity	IBA	21873635
GO:0032454	Function	Histone demethylase activity (H3-K9 specific)	IBA	21873635
GO:0032454	Function	Histone demethylase activity (H3-K9 specific)	IDA	18066052, 21914792
GO:0032454	Function	Histone demethylase activity (H3-K9 specific)	IMP	17277772, 28262558
GO:0033169	Process	Histone H3-K9 demethylation	IDA	18066052, 21914792
GO:0033169	Process	Histone H3-K9 demethylation	IMP	17277772, 28262558
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0050681	Function	Androgen receptor binding	IPI	17277772
GO:0051864	Function	Histone demethylase activity (H3-K36 specific)	IBA	21873635
GO:0051864	Function	Histone demethylase activity (H3-K36 specific)	IDA	21914792
GO:0070544	Process	Histone H3-K36 demethylation	IDA	21914792

Other IDs

• MIM: 605469
• HGNC: 17071
• e!Ensembl: ENSG00000107077

Protein

• UniProt ID: Q9H3R0
• Protein name: Lysine-specific demethylase 4C (EC 1.14.11.66) (Gene amplified in squamous cell carcinoma 1 protein) (GASC-1 protein) (JmjC domain-containing histone demethylation protein 3C) (Jumonji domain-containing protein 2C) ([histone H3]-trimethyl-L-lysine(9) deme
• Protein function: Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 '
• PDB: 2XDP, 2XML, 4XDO, 4XDP, 5FJH, 5FJK, 5KR7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02375	JmjN	17 → 51	jmjN domain	Family
  PF02373	JmjC	177 → 293	JmjC domain, hydroxylase	Domain
  PF13831	PHD_2	712 → 747		Family
  PF13832	zf-HC5HC2H_2	753 → 864		Domain
  PF18104	Tudor_2	882 → 916	Jumonji domain-containing protein 2A Tudor domain	Domain
  PF18104	Tudor_2	940 → 974	Jumonji domain-containing protein 2A Tudor domain	Domain

• Sequence:

  MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
  YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
  RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
  GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
  RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
  YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
  QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
  KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
  SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
  PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
  LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
  NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
  CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
  AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
  AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
  AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
  NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
  KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ

• Sequence length: 1056

Pathways

Reactome:

HDMs demethylate histones
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	19270706
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	29438700
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	30285260, 28991256

Unknown
Disease name	Disease term	dbSNP ID	References
Medullomyoblastoma	Medullomyoblastoma		19270706
T-cell lymphoma	T-Cell Lymphoma		29438700