KLRK1 (killer cell lectin like receptor K1)

Gene

• Entrez ID: 22914
• Gene name: Killer cell lectin like receptor K1
• Gene symbol: KLRK1
• Synonyms: CD314, D12S2489E, KLR, NKG2-D, NKG2D
• Chromosome: 12
• Chromosome location: 12p13.2
• Summary: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017175	hsa-miR-335-5p	Microarray	18185580
MIRT019249	hsa-miR-148b-3p	Microarray	17612493
MIRT021363	hsa-miR-9-5p	Microarray	17612493
MIRT1099411	hsa-miR-103b	CLIP-seq
MIRT1099412	hsa-miR-1236	CLIP-seq
MIRT1099413	hsa-miR-205	CLIP-seq
MIRT1099414	hsa-miR-331-3p	CLIP-seq
MIRT1099415	hsa-miR-4292	CLIP-seq
MIRT1099416	hsa-miR-4420	CLIP-seq
MIRT1099417	hsa-miR-4496	CLIP-seq
MIRT1099418	hsa-miR-4753-3p	CLIP-seq
MIRT1099419	hsa-miR-548p	CLIP-seq
MIRT1099420	hsa-miR-942	CLIP-seq
MIRT2026962	hsa-miR-124	CLIP-seq
MIRT2026963	hsa-miR-4641	CLIP-seq
MIRT2026964	hsa-miR-4711-3p	CLIP-seq
MIRT2026965	hsa-miR-506	CLIP-seq
MIRT2026966	hsa-miR-593	CLIP-seq
MIRT2026967	hsa-miR-649	CLIP-seq
MIRT2452710	hsa-miR-1291	CLIP-seq
MIRT2452711	hsa-miR-3173-5p	CLIP-seq
MIRT2452712	hsa-miR-328	CLIP-seq
MIRT2026963	hsa-miR-4641	CLIP-seq
MIRT2452713	hsa-miR-663b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATM	Activation	19767562

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0005515	Function	Protein binding	IPI	10426993, 10426994, 11323699, 11754823, 15240696, 18544572, 19424970, 19436053, 19658097, 21712812, 23696226, 28559451, 32296183
GO:0005886	Component	Plasma membrane	IDA	17562706
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	2007850
GO:0007165	Process	Signal transduction	TAS	2007850
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	IDA	10426994, 15294961
GO:0016021	Component	Integral component of membrane	TAS	9683661
GO:0030101	Process	Natural killer cell activation	TAS	18676862
GO:0030154	Process	Cell differentiation	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031295	Process	T cell costimulation	TAS	18676862
GO:0034260	Process	Negative regulation of GTPase activity	IDA	22585739
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0038023	Function	Signaling receptor activity	IDA	17562706
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	17562706
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IBA	21873635
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	15294961
GO:0050776	Process	Regulation of immune response	TAS
GO:2000502	Process	Negative regulation of natural killer cell chemotaxis	IDA	22585739

Other IDs

• MIM: 611817
• HGNC: 18788
• e!Ensembl: ENSG00000213809

Protein

• UniProt ID: P26718
• Protein name: NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
• Protein function: Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory
• PDB: 1HYR, 1KCG, 1MPU, 4PDC, 4S0U, 8TM0, 8TM2, 9DH2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	116 → 213	Lectin C-type domain	Domain

• Sequence:

  MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
  VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
  YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
  IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

• Sequence length: 216

Pathways

KEGG:

Natural killer cell mediated cytotoxicity
Malaria

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	17295095