NLGN1 (neuroligin 1)

Gene

• Entrez ID: 22871
• Gene name: Neuroligin 1
• Gene symbol: NLGN1
• Synonyms: NL1, NLG1
• Chromosome: 3
• Chromosome location: 3q26.31
• Summary: This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. [provided b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT720878	hsa-miR-5088-5p	HITS-CLIP	19536157
MIRT720877	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT720876	hsa-miR-3158-3p	HITS-CLIP	19536157
MIRT708819	hsa-miR-4705	HITS-CLIP	19536157
MIRT708818	hsa-miR-31-3p	HITS-CLIP	19536157
MIRT708817	hsa-miR-1251-3p	HITS-CLIP	19536157
MIRT708816	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708815	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT708819	hsa-miR-4705	HITS-CLIP	19536157
MIRT708818	hsa-miR-31-3p	HITS-CLIP	19536157
MIRT708817	hsa-miR-1251-3p	HITS-CLIP	19536157
MIRT708816	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708815	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT736302	hsa-miR-128-3p	Western blotting, qRT-PCR	32058631
MIRT720878	hsa-miR-5088-5p	HITS-CLIP	19536157
MIRT720877	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT720876	hsa-miR-3158-3p	HITS-CLIP	19536157
MIRT708819	hsa-miR-4705	HITS-CLIP	19536157
MIRT708818	hsa-miR-31-3p	HITS-CLIP	19536157
MIRT708817	hsa-miR-1251-3p	HITS-CLIP	19536157
MIRT708816	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708815	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT708819	hsa-miR-4705	HITS-CLIP	19536157
MIRT708818	hsa-miR-31-3p	HITS-CLIP	19536157
MIRT708817	hsa-miR-1251-3p	HITS-CLIP	19536157
MIRT708816	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT708815	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT1186650	hsa-miR-129-5p	CLIP-seq
MIRT1186651	hsa-miR-145	CLIP-seq
MIRT1186652	hsa-miR-197	CLIP-seq
MIRT1186653	hsa-miR-300	CLIP-seq
MIRT1186654	hsa-miR-3144-3p	CLIP-seq
MIRT1186655	hsa-miR-3149	CLIP-seq
MIRT1186656	hsa-miR-3671	CLIP-seq
MIRT1186657	hsa-miR-369-3p	CLIP-seq
MIRT1186658	hsa-miR-374a	CLIP-seq
MIRT1186659	hsa-miR-374b	CLIP-seq
MIRT1186660	hsa-miR-381	CLIP-seq
MIRT1186661	hsa-miR-4286	CLIP-seq
MIRT1186662	hsa-miR-4659a-3p	CLIP-seq
MIRT1186663	hsa-miR-4659b-3p	CLIP-seq
MIRT1186664	hsa-miR-4666-3p	CLIP-seq
MIRT1186665	hsa-miR-4778-3p	CLIP-seq
MIRT1186666	hsa-miR-496	CLIP-seq
MIRT1186667	hsa-miR-568	CLIP-seq
MIRT1186668	hsa-miR-607	CLIP-seq
MIRT1186669	hsa-miR-875-5p	CLIP-seq
MIRT2054100	hsa-miR-526b	CLIP-seq
MIRT2581563	hsa-miR-33a	CLIP-seq
MIRT2581564	hsa-miR-33b	CLIP-seq
MIRT2581565	hsa-miR-340	CLIP-seq
MIRT2686386	hsa-miR-193a-3p	CLIP-seq
MIRT2686387	hsa-miR-193b	CLIP-seq
MIRT2686388	hsa-miR-2277-3p	CLIP-seq
MIRT2686389	hsa-miR-3128	CLIP-seq
MIRT2581563	hsa-miR-33a	CLIP-seq
MIRT2581564	hsa-miR-33b	CLIP-seq
MIRT2581565	hsa-miR-340	CLIP-seq
MIRT2686390	hsa-miR-3689a-5p	CLIP-seq
MIRT2686391	hsa-miR-3689b	CLIP-seq
MIRT2686392	hsa-miR-3689e	CLIP-seq
MIRT2686393	hsa-miR-3689f	CLIP-seq
MIRT2686394	hsa-miR-4291	CLIP-seq
MIRT2686395	hsa-miR-4310	CLIP-seq
MIRT2686396	hsa-miR-4470	CLIP-seq
MIRT2686397	hsa-miR-4501	CLIP-seq
MIRT2686398	hsa-miR-4722-3p	CLIP-seq
MIRT2686399	hsa-miR-513a-3p	CLIP-seq
MIRT2686400	hsa-miR-892b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	NAS	21838267
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005886	Component	Plasma membrane	IMP	28841651
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0005887	Component	Integral component of plasma membrane	NAS	14522992
GO:0006605	Process	Protein targeting	ISS
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS
GO:0007158	Process	Neuron cell-cell adhesion	IBA	21873635
GO:0007158	Process	Neuron cell-cell adhesion	ISS
GO:0007158	Process	Neuron cell-cell adhesion	NAS	25428619
GO:0007158	Process	Neuron cell-cell adhesion	TAS	15797875
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007399	Process	Nervous system development	IMP	28841651
GO:0007399	Process	Nervous system development	ISS
GO:0007416	Process	Synapse assembly	ISS
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	ISS	26440732
GO:0010841	Process	Positive regulation of circadian sleep/wake cycle, wakefulness	ISS
GO:0014069	Component	Postsynaptic density	ISS
GO:0014069	Component	Postsynaptic density	TAS	15797875
GO:0016080	Process	Synaptic vesicle targeting	ISS
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	ISS
GO:0017146	Component	NMDA selective glutamate receptor complex	IEA
GO:0023041	Process	Neuronal signal transduction	TAS	15797875
GO:0030165	Function	PDZ domain binding	IDA	17474715
GO:0030425	Component	Dendrite	ISS
GO:0031175	Process	Neuron projection development	IDA	22750515
GO:0031175	Process	Neuron projection development	ISS
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	ISS
GO:0032433	Component	Filopodium tip	ISS
GO:0035418	Process	Protein localization to synapse	ISS
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0038023	Function	Signaling receptor activity	ISS
GO:0042043	Function	Neurexin family protein binding	IBA	21873635
GO:0042043	Function	Neurexin family protein binding	ISS
GO:0042043	Function	Neurexin family protein binding	NAS	14522992
GO:0042802	Function	Identical protein binding	ISS
GO:0043083	Component	Synaptic cleft	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043235	Component	Receptor complex	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045184	Process	Establishment of protein localization	ISS
GO:0045202	Component	Synapse	IBA	21873635
GO:0045202	Component	Synapse	ISS
GO:0045664	Process	Regulation of neuron differentiation	ISS
GO:0048488	Process	Synaptic vesicle endocytosis	IBA	21873635
GO:0048489	Process	Synaptic vesicle transport	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048789	Process	Cytoskeletal matrix organization at active zone	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	ISS
GO:0050839	Function	Cell adhesion molecule binding	ISS
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IDA	24613359
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060076	Component	Excitatory synapse	NAS	25428619
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	IGI	23143522
GO:0060999	Process	Positive regulation of dendritic spine development	ISS
GO:0061002	Process	Negative regulation of dendritic spine morphogenesis	IGI	23143522
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0072553	Process	Terminal button organization	ISS
GO:0089717	Component	Spanning component of membrane	TAS	21838267
GO:0097091	Process	Synaptic vesicle clustering	ISS
GO:0097104	Process	Postsynaptic membrane assembly	IBA	21873635
GO:0097104	Process	Postsynaptic membrane assembly	ISS
GO:0097105	Process	Presynaptic membrane assembly	IBA	21873635
GO:0097105	Process	Presynaptic membrane assembly	ISS
GO:0097110	Function	Scaffold protein binding	IDA	17474715
GO:0097113	Process	AMPA glutamate receptor clustering	ISS
GO:0097114	Process	NMDA glutamate receptor clustering	ISS
GO:0097115	Process	Neurexin clustering involved in presynaptic membrane assembly	ISS
GO:0097119	Process	Postsynaptic density protein 95 clustering	ISS
GO:0097120	Process	Receptor localization to synapse	ISS
GO:0098698	Process	Postsynaptic specialization assembly	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	NAS	14522992
GO:0098942	Process	Retrograde trans-synaptic signaling by trans-synaptic protein complex	IEA
GO:0098985	Component	Asymmetric, glutamatergic, excitatory synapse	TAS	21838267
GO:0099054	Process	Presynapse assembly	TAS	21838267
GO:0099055	Component	Integral component of postsynaptic membrane	TAS	15797875
GO:0099060	Component	Integral component of postsynaptic specialization membrane	IEA
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:0140058	Process	Neuron projection arborization	ISS
GO:1900029	Process	Positive regulation of ruffle assembly	ISS
GO:1900244	Process	Positive regulation of synaptic vesicle endocytosis	ISS
GO:1902474	Process	Positive regulation of protein localization to synapse	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS
GO:1904861	Process	Excitatory synapse assembly	ISS	26440732
GO:1905520	Process	Positive regulation of presynaptic active zone assembly	IEA
GO:2000302	Process	Positive regulation of synaptic vesicle exocytosis	ISS
GO:2000310	Process	Regulation of NMDA receptor activity	IGI	23143522
GO:2000310	Process	Regulation of NMDA receptor activity	ISS
GO:2000311	Process	Regulation of AMPA receptor activity	ISS
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IGI	23143522
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS
GO:2000809	Process	Positive regulation of synaptic vesicle clustering	IEA

Other IDs

• MIM: 600568
• HGNC: 14291
• e!Ensembl: ENSG00000169760

Protein

• UniProt ID: Q8N2Q7
• Protein name: Neuroligin-1
• Protein function: Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and probably mediates its effects by recruiting and clustering other sy
• PDB: 5OJ6, 5OJK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00135	COesterase	51 → 646	Carboxylesterase family	Domain

• Sequence:

  MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFG
  KIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQN
  IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDVKRISKECARKPGKKI
  CRKGGPLTKKQTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASY
  GNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGS
  GAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKV
  GCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLN
  YDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMY
  TDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAW
  ADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDT
  KFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDIS
  QYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTI
  AVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDL
  DHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTF
  TGGQNNTLPHPHPHPHSHSTTRV

• Sequence length: 863

Pathways

KEGG:

Cell adhesion molecules

Reactome:

Neurexins and neuroligins

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Attention deficit hyperactivity disorder	Attention deficit hyperactivity disorder	rs120074176, rs786205019	27890468
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	19404257
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	28736931
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21915259, 26198764

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		21915259, 27890468
Motion sickness	Motion Sickness		25628336