FGF2 (fibroblast growth factor 2)

Gene

• Entrez ID: 2247
• Gene name: Fibroblast growth factor 2
• Gene symbol: FGF2
• Synonyms: BFGF, FGF-2, FGFB, HBGF-2
• Chromosome: 4
• Chromosome location: 4q28.1
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001468	hsa-miR-16-5p	pSILAC, Proteomics;Other	18668040
MIRT001468	hsa-miR-16-5p	Sequencing, PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT003962	hsa-miR-140-5p	Microarray	17875710
MIRT007223	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	23263626
MIRT020683	hsa-miR-155-5p	Proteomics	18668040
MIRT021161	hsa-miR-186-5p	Sequencing	20371350
MIRT021161	hsa-miR-186-5p	Luciferase reporter assay	28213656
MIRT024732	hsa-miR-215-5p	Microarray	19074876
MIRT026446	hsa-miR-192-5p	Microarray	19074876
MIRT027141	hsa-miR-103a-3p	Sequencing, PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	Sequencing, PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT028310	hsa-miR-32-5p	PAR-CLIP	22012620
MIRT028310	hsa-miR-32-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	CLASH	23622248
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	22012620
MIRT049684	hsa-miR-92a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	qRT-PCR	24560946
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	23446348
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	23446348
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28500362
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211201	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	23263626
MIRT211201	hsa-miR-424-5p	qRT-PCR, Western blot	28186136
MIRT211202	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211204	hsa-miR-1276	PAR-CLIP	20371350
MIRT211205	hsa-miR-2278	PAR-CLIP	20371350
MIRT211206	hsa-miR-3148	PAR-CLIP	20371350
MIRT211207	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT211208	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT211209	hsa-miR-451b	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT211211	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT211223	hsa-miR-25-3p	PAR-CLIP	22012620
MIRT211223	hsa-miR-25-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT211227	hsa-miR-363-3p	PAR-CLIP	22012620
MIRT211227	hsa-miR-363-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT211228	hsa-miR-367-3p	PAR-CLIP	22012620
MIRT211228	hsa-miR-367-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT211229	hsa-miR-495-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	22012620
MIRT211230	hsa-miR-92b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT211231	hsa-miR-548c-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	23592263
MIRT211232	hsa-miR-5688	PAR-CLIP	23446348
MIRT211232	hsa-miR-5688	PAR-CLIP, HITS-CLIP	21572407
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT211238	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT211239	hsa-miR-600	PAR-CLIP	22012620
MIRT211252	hsa-miR-646	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT211257	hsa-miR-545-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT211258	hsa-miR-1468-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	22012620
MIRT211261	hsa-miR-548p	PAR-CLIP, HITS-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT211264	hsa-miR-6504-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211265	hsa-miR-107	PAR-CLIP	20371350
MIRT211270	hsa-miR-3686	PAR-CLIP	20371350
MIRT309153	hsa-miR-222-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT309159	hsa-miR-936	PAR-CLIP, HITS-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	23446348
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23592263
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	22012620
MIRT476869	hsa-miR-5589-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	23592263
MIRT476870	hsa-miR-759	PAR-CLIP	23446348
MIRT476870	hsa-miR-759	PAR-CLIP	22012620
MIRT476870	hsa-miR-759	PAR-CLIP, HITS-CLIP	21572407
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23446348
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT476871	hsa-miR-5003-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	23446348
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	23446348
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	23446348
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT537376	hsa-miR-376b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT537377	hsa-miR-376a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT537378	hsa-miR-6853-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT537379	hsa-miR-1206	PAR-CLIP	22012620
MIRT537379	hsa-miR-1206	PAR-CLIP, HITS-CLIP	21572407
MIRT537380	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT537381	hsa-miR-3529-3p	PAR-CLIP	22012620
MIRT537382	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT537383	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT537384	hsa-miR-466	PAR-CLIP	22012620
MIRT537385	hsa-miR-1284	PAR-CLIP	22012620
MIRT537386	hsa-miR-4729	PAR-CLIP	22012620
MIRT537387	hsa-miR-4643	PAR-CLIP	22012620
MIRT537389	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT557864	hsa-miR-26b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT557868	hsa-miR-3935	PAR-CLIP	21572407
MIRT557869	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT557870	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT557871	hsa-miR-577	PAR-CLIP	21572407
MIRT557872	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT562330	hsa-miR-4659b-3p	PAR-CLIP	20371350
MIRT562331	hsa-miR-4659a-3p	PAR-CLIP	20371350
MIRT562332	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT574769	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT574770	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT574771	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT574772	hsa-miR-3122	PAR-CLIP	20371350
MIRT574773	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT574774	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT574775	hsa-miR-3153	PAR-CLIP	20371350
MIRT724418	hsa-miR-1305	HITS-CLIP	19536157
MIRT724419	hsa-miR-607	HITS-CLIP	19536157
MIRT724420	hsa-miR-3671	HITS-CLIP	19536157
MIRT724421	hsa-miR-1976	HITS-CLIP	19536157
MIRT724422	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT731959	hsa-miR-196a-3p	Microarray, qRT-PCR, Western blot	28317323
MIRT732595	hsa-miR-132-3p	qRT-PCR	25864118
MIRT733586	hsa-miR-205-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	27362808
MIRT734136	hsa-miR-152-5p	Luciferase reporter assay, qRT-PCR, Western blot	28258379
MIRT735202	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25890121
MIRT735540	hsa-miR-195-3p	Luciferase reporter assay, Western blot	26650737

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Activation	8702507
ERG	Repression	12137767
HDAC5	Repression	19351956
HIF1A	Activation	19492421
HOXB7	Activation	21183939;8756643
LMO2	Activation	20955387
PTTG1	Unknown	12213878
STAT1	Activation	23086340
STAT1	Repression	23086340
STAT3	Activation	21418908;23086340
STAT3	Unknown	16540670
TP53	Repression	10029407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000187	Process	Activation of MAPK activity	TAS	9712850
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IDA	12631064
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	16756958, 31915155
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IGI	19351956
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA	21873635
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	2161540, 10830168
GO:0005125	Function	Cytokine activity	IDA	18059339
GO:0005178	Function	Integrin binding	IDA	28302677
GO:0005515	Function	Protein binding	IPI	9700203, 10490103, 10830168, 11030354, 11075807, 11390973, 11716516, 12717444, 14613973, 16257968, 17086194, 18329368, 20363749, 22267482, 23597562, 23597563, 26267536
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	2161540
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006661	Process	Phosphatidylinositol biosynthetic process	IDA	20011604
GO:0006935	Process	Chemotaxis	TAS
GO:0007165	Process	Signal transduction	NAS	9712850
GO:0007265	Process	Ras protein signal transduction	TAS
GO:0007399	Process	Nervous system development	TAS	9576942
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008083	Function	Growth factor activity	IDA	18059339, 26451614
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2161540
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	16774925, 17500071, 31915155
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	2161540, 8663044, 26451614
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10830168
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0009887	Process	Animal organ morphogenesis	IBA	21873635
GO:0010595	Process	Positive regulation of endothelial cell migration	IBA	21873635
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	31915155
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010629	Process	Negative regulation of gene expression	NAS	24463821
GO:0010764	Process	Negative regulation of fibroblast migration	IDA	19577615
GO:0010863	Process	Positive regulation of phospholipase C activity	IDA	20011604
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IGI	31915155
GO:0014843	Process	Growth factor dependent regulation of skeletal muscle satellite cell proliferation	IMP	18602469
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019956	Function	Chemokine binding	IPI	11708770
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030214	Process	Hyaluronan catabolic process	IDA	19577615
GO:0030324	Process	Lung development	IBA	21873635
GO:0030334	Process	Regulation of cell migration	IBA	21873635
GO:0030374	Function	Nuclear receptor coactivator activity	IDA	17500071
GO:0032958	Process	Inositol phosphate biosynthetic process	IDA	20011604
GO:0035019	Process	Somatic stem cell population maintenance	TAS
GO:0038001	Process	Paracrine signaling	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	NAS	24463821
GO:0042056	Function	Chemoattractant activity	IDA	18059339
GO:0042060	Process	Wound healing	IBA	21873635
GO:0042060	Process	Wound healing	IDA	16756958
GO:0042060	Process	Wound healing	TAS	20011604
GO:0042660	Process	Positive regulation of cell fate specification	IDA	18635606
GO:0042802	Function	Identical protein binding	IPI	11708770
GO:0043406	Process	Positive regulation of MAP kinase activity	IBA	21873635
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	26451614, 31915155
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	18555217, 20011604, 28302677
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	23263626
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IDA	20011604
GO:0045765	Process	Regulation of angiogenesis	TAS	20011604
GO:0045766	Process	Positive regulation of angiogenesis	IDA	16774925, 20011604, 28302677
GO:0045766	Process	Positive regulation of angiogenesis	IGI	16774925
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	17500071
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18059339
GO:0048598	Process	Embryonic morphogenesis	TAS	20011604
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IBA	21873635
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	20011604
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	26451614, 31915155
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IDA	9553078
GO:0060548	Process	Negative regulation of cell death	IDA	12631064
GO:0060591	Process	Chondroblast differentiation	IDA	17167778
GO:0061045	Process	Negative regulation of wound healing	IDA	19577615
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17167778
GO:0072089	Process	Stem cell proliferation	NAS	25640183
GO:0090049	Process	Regulation of cell migration involved in sprouting angiogenesis	NAS	24463821
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IDA	28302677
GO:0090722	Function	Receptor-receptor interaction	IDA	24157794
GO:1902748	Process	Positive regulation of lens fiber cell differentiation	IDA	29501879
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	NAS	24463821
GO:1903587	Process	Regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	NAS	24463821
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	16756958
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	23469107
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	23263626
GO:1905278	Process	Positive regulation of epithelial tube formation	IDA	31915155
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IGI	23263626
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	NAS	24463821
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IDA	16774925
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IGI	16774925
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IGI	16774925

Other IDs

• MIM: 134920
• HGNC: 3676
• e!Ensembl: ENSG00000138685

Protein

• UniProt ID: P09038
• Protein name: Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)
• Protein function: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed:8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed:28302677). Binds to integrin ITGAV:ITGB3 (PubMed:28302677). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (PubMed:8663044, PubMed:28302677). Functions as a potent mitogen in vitro (PubMed:1721615, PubMed:3964259, PubMed:3732516). Can induce angiogenesis (PubMed:23469107, PubMed:28302677). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (PubMed:29501879).
• PDB: 1BAS, 1BFB, 1BFC, 1BFF, 1BFG, 1BLA, 1BLD, 1CVS, 1EV2, 1FGA, 1FQ9, 1II4, 1IIL, 2BFH, 2FGF, 2M49, 4FGF, 4OEE, 4OEF, 4OEG, 5X1O, 6L4O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	162 → 282	Fibroblast growth factor	Domain

• Sequence:

  MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
  GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
  PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
  RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
  ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

• Sequence length: 288

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - receptor activation
Melanoma
Breast cancer
Gastric cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
Signaling by activated point mutants of FGFR1
Signaling by activated point mutants of FGFR3
FGFR4 ligand binding and activation
FGFR1b ligand binding and activation
FGFR3c ligand binding and activation
FGFR1c ligand binding and activation
FGFR2c ligand binding and activation
FGFR2b ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Syndecan interactions
Non-integrin membrane-ECM interactions
Phospholipase C-mediated cascade: FGFR1
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
Downstream signaling of activated FGFR1
SHC-mediated cascade:FGFR1
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR1 in disease
FGFRL1 modulation of FGFR1 signaling
RAF/MAP kinase cascade
Interleukin-4 and Interleukin-13 signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 point mutants in cancer

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910, rs1568296260, rs119473033, rs74315342, rs74315343, rs74315345, rs74315346, rs74315347, rs74315348, rs121434394, rs267606919, rs121912488, rs267606953, rs267606954, rs267606955, rs104886210, rs1591732280, rs1591750243, rs140511594, rs140781106, rs147972030, rs587776969, rs386833863, rs386833880, rs386833882, rs386833892, rs386833895, rs386833909, rs386833911, rs386833920, rs386833935, rs386833947, rs1555763603, rs398122978, rs398122979, rs398122980, rs369573693, rs398122981, rs398122982, rs398122983, rs200482683, rs730882194, rs180177201, rs587777552, rs587777553, rs775170915, rs749740335, rs12568913, rs530318579, rs786204583, rs786204708, rs786204632, rs138656762, rs797044992, rs797044994, rs797044995, rs864321632, rs864321687, rs864321688, rs864321633, rs869025495, rs869025541, rs869312747, rs145473779, rs757674160, rs869320695, rs138909849, rs869312984, rs1057516900, rs763818901, rs199506378, rs1057517164, rs1057516523, rs1057516414, rs778055996, rs1057516395, rs1057516747, rs1057516880, rs1057516680, rs778217926, rs1057519347, rs764587648, rs1060499703, rs121907903, rs769259446, rs1131692252, rs1131692253, rs1131692254, rs1131692255, rs1131692256, rs746887949, rs1131692235, rs1135402911, rs1135402912, rs1135402913, rs1554946480, rs1555331969, rs773173317, rs1555816634, rs775006954, rs1320543506, rs534522842, rs1272948499, rs1191455921, rs1291398331, rs1554939785, rs776016942, rs1031744496, rs748812981, rs755972674, rs1553312833, rs967339926, rs1462028977, rs1212702104, rs1167223941, rs762631237, rs1553316575, rs1553315173, rs1553316648, rs1553316611, rs780761368, rs368572297, rs1568070817, rs1321552081, rs1558108130, rs1558091788, rs1565707103, rs1558355124, rs1564622701, rs1351580598, rs1589475328, rs1589413498, rs1572255744, rs1572262824, rs761410195, rs1602413491, rs1590326226, rs375998390, rs570583897, rs369363545, rs201488687, rs1334894971, rs763782471, rs138047529, rs895782232, rs1572255047, rs1589433172, rs1589509476, rs1572277600, rs1572282458, rs1584675898, rs759043857, rs1853443391	21441931
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs-1, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	11264663
Epilepsy	Epilepsy, Tonic-Clonic, Familial, Epilepsy, Tonic-Clonic, Symptomatic	rs113994140, rs119454947, rs28937874, rs-1, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	16023256
Mesothelioma	Mesothelioma	rs121907908, rs387906350, rs387906351	15878867
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs-1, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	21269288
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	8995747
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	12644816
Periodontitis	Periodontitis, Acute Nonsuppurative	rs28937571, rs104894211, rs587777534	16631837
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	8952537
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs-1, rs1339631701	10673511
Thrombocythemia	Thrombocythemia, Essential	rs2108623965, rs771269271, rs121913614, rs77375493, rs1555760738, rs-1, rs750046020, rs148434485, rs1714397896	15682418

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Endogenous depression, Depressive disorder, Unipolar Depression, Depressive Syndrome, Depression, Neurotic	rs587778876, rs587778877	16861106
Alveolitis	Alveolitis, Fibrosing		8952537
Brain infarction	Brain Infarction		17524524
Clonic seizures	Clonic Seizures		21269288
Corneal neovascularization	Corneal Neovascularization		9301478
Cryptogenic tonic-clonic epilepsy	Cryptogenic Tonic-Clonic Epilepsy		16023256
Hypotonic seizures	Epileptic drop attack		21269288
Jacksonian seizure	Jacksonian Seizure		21269288
Liver cirrhosis	Liver Cirrhosis		17093919
Liver fibrosis	Fibrosis, Liver		17093919
Melancholia	Melancholia		16861106
Mood disorder	Mood Disorders		26351673, 19439615, 21518861
Myocardial ischemia	Myocardial Ischemia		14583313, 12173832
Nephrosclerosis	Nephrosclerosis		30818366
Oral submucous fibrosis	Oral Submucous Fibrosis		16311067
Periapical periodontitis	Periapical Periodontitis		16631837
Prostatic neoplasms	Prostatic Neoplasms		12644816
Thrombocytosis	Thrombocytosis, Autosomal Dominant		15682418
Tonic-clonic epilepsy	Tonic-Clonic Epilepsy		16023256