FCGR3A (Fc gamma receptor IIIa)

Gene

• Entrez ID: 2214
• Gene name: Fc gamma receptor IIIa
• Gene symbol: FCGR3A
• Synonyms: CD16, CD16-II, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, FcGRIIIA, IGFR3, IMD20
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs396991	A>C,G,T	Likely-benign, drug-response	Intron variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT993883	hsa-miR-1292	CLIP-seq
MIRT993884	hsa-miR-1294	CLIP-seq
MIRT993885	hsa-miR-1301	CLIP-seq
MIRT993886	hsa-miR-3126-5p	CLIP-seq
MIRT993887	hsa-miR-4316	CLIP-seq
MIRT993888	hsa-miR-4419a	CLIP-seq
MIRT993889	hsa-miR-4510	CLIP-seq
MIRT993890	hsa-miR-4660	CLIP-seq
MIRT993891	hsa-miR-4677-3p	CLIP-seq
MIRT993892	hsa-miR-4738-3p	CLIP-seq
MIRT993893	hsa-miR-5047	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006955	Process	Immune response	TAS	2138330
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	10706735, 24942581
GO:0019864	Function	IgG binding	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0050776	Process	Regulation of immune response	IBA	21873635
GO:0050776	Process	Regulation of immune response	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 146740
• HGNC: 3619
• e!Ensembl: ENSG00000203747

Protein

• UniProt ID: P08637
• Protein name: Low affinity immunoglobulin gamma Fc region receptor III-A (IgG Fc receptor III-A) (CD16-II) (CD16a antigen) (Fc-gamma RIII-alpha) (Fc-gamma RIII) (Fc-gamma RIIIa) (FcRIII) (FcRIIIa) (FcgammaRIIIA) (FcR-10) (IgG Fc receptor III-2) (CD antigen CD16a)
• Protein function: Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent
• PDB: 3AY4, 3SGJ, 3SGK, 3WN5, 5BW7, 5D6D, 5ML9, 5MN2, 5VU0, 5XJE, 5XJF, 5YC5, 7SEG, 7URU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	27 → 104	Immunoglobulin domain	Domain
  PF13895	Ig_2	108 → 190	Immunoglobulin domain	Domain

• Sequence:

  MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW
  FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
  EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN
  VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
  KDHKFKWRKDPQDK

• Sequence length: 254

Pathways

KEGG:

Phagosome
Osteoclast differentiation
Neutrophil extracellular trap formation
Natural killer cell mediated cytotoxicity
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
FCGR activation
Regulation of actin dynamics for phagocytic cup formation
Role of phospholipids in phagocytosis
FCGR3A-mediated IL10 synthesis
FCGR3A-mediated phagocytosis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Immunodeficiency	IMMUNODEFICIENCY 20	rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866, rs483352928, rs121918659, rs111033580, rs111033581, rs74315290, rs193922740, rs193922741, rs104894199, rs483352927, rs104894286, rs1571865049, rs886041032, rs2069709, rs587776822, rs74315444, rs587776823, rs1315265916, rs104893893, rs104893894, rs121434560, rs387906572, rs587776853, rs104893973, rs587776854, rs587776855, rs587776857, rs104893974, rs121912715, rs1393707607, rs113994136, rs387906593, rs587776870, rs387906763, rs387906913, rs199469663, rs199469662, rs199469664, rs193922640, rs193922641, rs193922645, rs398122890, rs387907316, rs397514710, rs398122383, rs397515453, rs397514332, rs398123058, rs397518423, rs587777075, rs199676861, rs77563738, rs587777337, rs28730670, rs587777389, rs587777390, rs587777413, rs587777414, rs587777415, rs587777416, rs267608260, rs267608261, rs587778405, rs587777446, rs587777562, rs587777564, rs587777565, rs869320745, rs587777709, rs606231305, rs672601318, rs727503779, rs727503780, rs730880296, rs786200953, rs375323253, rs794729666, rs886041037, rs886041038, rs796051887, rs796051888, rs749956849, rs199641706, rs775739391, rs869312886, rs869312857, rs879253731, rs879253732, rs201025290, rs770927552, rs878853275, rs878853276, rs878853277, rs878853278, rs1567506566, rs886037920, rs886037921, rs750610248, rs200044623, rs886043118, rs886060531, rs1057519074, rs1057519075, rs1057518744, rs1057519079, rs1057518745, rs1057518746, rs1057518747, rs782178147, rs55729925, rs1064795762, rs1064794957, rs1085307649, rs745463649, rs773694113, rs1192554889, rs779575307, rs1554051075, rs1554051067, rs1554051033, rs1554067182, rs1555167566, rs1555169270, rs1555908409, rs1555719963, rs1554064929, rs768091235, rs1404084330, rs144104577, rs1553238837, rs1553243550, rs1554020278, rs1554066684, rs762678772, rs570768621, rs1443126481, rs1553721236, rs121434258, rs888230251, rs1759915032, rs1759514836, rs138156467, rs1560914625, rs755373718, rs1561423197, rs1560938296, rs200803157, rs766555082, rs201543770, rs114951157, rs775578531, rs201128237, rs778624945, rs1563340753, rs1561772403, rs1484948342, rs777878144, rs1562364898, rs1561254290, rs1569296295, rs1568815169, rs1568822574, rs1571880832, rs934523851, rs1922072844, rs1266114717, rs137869655, rs869320689, rs1571880941, rs1580875488, rs1581303476, rs1448018291, rs1390410878, rs774803573, rs1591278347, rs1602300615, rs1601340933, rs757598952, rs1181595292, rs1408683294, rs1595843113, rs1595848141, rs779560450, rs1595816926, rs1601861196, rs1601861199, rs756541321, rs1594389703, rs1594390415, rs1581401865, rs1236009877, rs753213766, rs778993919, rs1602878106, rs141698985, rs1264504989, rs1580974401, rs2093571190, rs530286781, rs2086875746, rs2089298923, rs1206185362, rs1581573705, rs1596718225, rs1004337827, rs1573613529, rs1574636674, rs1574657735, rs1574657762, rs1574672718, rs1581573640, rs1553657429, rs200666300, rs1578735747, rs1578771211, rs1578793312, rs1578795536, rs1578809101, rs1578811073, rs1578811245, rs1171694504, rs1578971328, rs140800288, rs374333820, rs1584926133, rs1585040113, rs1584409386, rs1379376784, rs1586940273, rs1587143342, rs748910652, rs1592117677, rs758555433, rs1596712783, rs34019455, rs147766868, rs751386365, rs1600631294, rs1489114116, rs1057520578, rs1603007888, rs1603008329, rs1574450161, rs1578735709, rs1403833564, rs1580262965, rs570910902, rs1589866171, rs1578999313, rs1582635229, rs1582637044, rs1580851910, rs1750760771, rs745453685, rs1249197356, rs201840561, rs1940921909, rs1941410085, rs1941465194, rs1321690789, rs1302362911, rs1730552437, rs2052705192, rs1941856970	23006327, 8608639, 8609432, 8874200

Unknown
Disease name	Disease term	dbSNP ID	References
Celiac disease	Celiac Disease	rs2305764, rs35218876	30097691
Immunodeficiency with defective spontaneous natural killer cell cytotoxicity	Autosomal recessive primary immunodeficiency with defective spontaneous natural killer cell cytotoxicity	rs10127939, rs769001959
Immunologic deficiency syndromes	Immunologic Deficiency Syndromes
Lupus meningoencephalitis	Lupus Meningoencephalitis		26773105
Central nervous system lupus	Lupus Vasculitis, Central Nervous System		26773105
Neuropsychiatric systemic lupus erythematosus	Neuropsychiatric Systemic Lupus Erythematosus		26773105
Otitis media	Recurrent otitis media	rs601338, rs1047781, rs1800028
Sinusitis	Recurrent sinusitis