FCGR2B (Fc gamma receptor IIb)

Gene

• Entrez ID: 2213
• Gene name: Fc gamma receptor IIb
• Gene symbol: FCGR2B
• Synonyms: CD32, CD32B, FCG2, FCGR2, FCGR2C, FcGRIIB, FcRII-c, FcgammaRIIb, IGFR2
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1050501	T>A,C	Risk-factor, protective	Genic downstream transcript variant, downstream transcript variant, coding sequence variant, missense variant
rs3219018	G>C	Risk-factor	Upstream transcript variant, intron variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438477	hsa-miR-18a-5p	qRT-PCR, Western blot	24169826
MIRT438477	hsa-miR-18a-5p	qRT-PCR, Western blot	24169826
MIRT993861	hsa-miR-1183	CLIP-seq
MIRT993862	hsa-miR-194	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq
MIRT993864	hsa-miR-4427	CLIP-seq
MIRT993865	hsa-miR-4724-5p	CLIP-seq
MIRT993866	hsa-miR-103a	CLIP-seq
MIRT993867	hsa-miR-107	CLIP-seq
MIRT993868	hsa-miR-1184	CLIP-seq
MIRT993869	hsa-miR-147	CLIP-seq
MIRT993862	hsa-miR-194	CLIP-seq
MIRT993870	hsa-miR-219-5p	CLIP-seq
MIRT993871	hsa-miR-339-5p	CLIP-seq
MIRT993872	hsa-miR-4287	CLIP-seq
MIRT993873	hsa-miR-4418	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq
MIRT993864	hsa-miR-4427	CLIP-seq
MIRT993874	hsa-miR-4445	CLIP-seq
MIRT993875	hsa-miR-4469	CLIP-seq
MIRT993876	hsa-miR-4666-5p	CLIP-seq
MIRT993877	hsa-miR-4685-3p	CLIP-seq
MIRT993865	hsa-miR-4724-5p	CLIP-seq
MIRT993878	hsa-miR-4742-5p	CLIP-seq
MIRT993879	hsa-miR-4782-3p	CLIP-seq
MIRT993880	hsa-miR-508-3p	CLIP-seq
MIRT993881	hsa-miR-509-3-5p	CLIP-seq
MIRT993882	hsa-miR-509-5p	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA4	Unknown	15153544
YY1	Unknown	15153544

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IPI	23921129
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001811	Process	Negative regulation of type I hypersensitivity	ISS	26683154
GO:0001814	Process	Negative regulation of antibody-dependent cellular cytotoxicity	TAS	26683154
GO:0001818	Process	Negative regulation of cytokine production	TAS	26683154
GO:0002266	Process	Follicular dendritic cell activation	TAS	26683154
GO:0002313	Process	Mature B cell differentiation involved in immune response	TAS	26683154
GO:0002316	Process	Follicular B cell differentiation	TAS	26683154
GO:0002436	Process	Immune complex clearance by monocytes and macrophages	TAS	26683154
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	TAS	26683154
GO:0002622	Process	Regulation of B cell antigen processing and presentation	TAS	26683154
GO:0002638	Process	Negative regulation of immunoglobulin production	ISS	26683154
GO:0002819	Process	Regulation of adaptive immune response	TAS	26683154
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	ISS	26683154
GO:0002922	Process	Positive regulation of humoral immune response	TAS	26683154
GO:0002924	Process	Negative regulation of humoral immune response mediated by circulating immunoglobulin	ISS	26683154
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8577729, 9148918, 9603468, 10382761, 11567028, 17474147, 24642916, 32814053
GO:0005886	Component	Plasma membrane	IDA	2142460
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	23921129
GO:0006898	Process	Receptor-mediated endocytosis	IDA	2142460
GO:0006911	Process	Phagocytosis, engulfment	ISS	26683154
GO:0006952	Process	Defense response	ISS	26683154
GO:0006954	Process	Inflammatory response	TAS	26683154
GO:0006955	Process	Immune response	TAS	2142460
GO:0007165	Process	Signal transduction	TAS	2142460
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0009617	Process	Response to bacterium	ISS	26683154
GO:0009897	Component	External side of plasma membrane	ISS	26683154
GO:0010469	Process	Regulation of signaling receptor activity	TAS	26683154
GO:0016032	Process	Viral process	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	ISS	26683154
GO:0019772	Function	Low-affinity IgG receptor activity	IDA	2142460
GO:0019864	Function	IgG binding	IDA	2142460
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	ISS	26683154
GO:0021549	Process	Cerebellum development	ISS	26683154
GO:0030889	Process	Negative regulation of B cell proliferation	ISS	26683154
GO:0032693	Process	Negative regulation of interleukin-10 production	ISS	26683154
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IDA	2142460
GO:0043031	Process	Negative regulation of macrophage activation	TAS	26683154
GO:0043197	Component	Dendritic spine	ISS	26683154
GO:0043318	Process	Negative regulation of cytotoxic T cell degranulation	TAS	26683154
GO:0044297	Component	Cell body	ISS	26683154
GO:0044877	Function	Protein-containing complex binding	IPI	23921129
GO:0045088	Process	Regulation of innate immune response	TAS	26683154
GO:0045576	Process	Mast cell activation	ISS	26683154
GO:0046330	Process	Positive regulation of JNK cascade	ISS	23921129
GO:0050765	Process	Negative regulation of phagocytosis	TAS	26683154
GO:0050766	Process	Positive regulation of phagocytosis	ISS	26683154
GO:0050776	Process	Regulation of immune response	IBA	21873635
GO:0050776	Process	Regulation of immune response	TAS
GO:0050777	Process	Negative regulation of immune response	ISS	26683154
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IMP	24169826
GO:0050869	Process	Negative regulation of B cell activation	TAS	26683154
GO:0071219	Process	Cellular response to molecule of bacterial origin	ISS	26683154
GO:0090264	Process	Regulation of immune complex clearance by monocytes and macrophages	TAS	26683154
GO:1901216	Process	Positive regulation of neuron death	ISS	23921129
GO:1902564	Process	Negative regulation of neutrophil activation	TAS	26683154
GO:1902950	Process	Regulation of dendritic spine maintenance	IGI	23921129
GO:1904646	Process	Cellular response to amyloid-beta	ISS	23921129
GO:1905898	Process	Positive regulation of response to endoplasmic reticulum stress	ISS	23921129
GO:2001199	Process	Negative regulation of dendritic cell differentiation	TAS	26683154

Other IDs

• MIM: 604590
• HGNC: 3618
• e!Ensembl: ENSG00000072694

Protein

• UniProt ID: P31994
• Protein name: Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)
• Protein function: Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-ce
• PDB: 2FCB, 3WJJ, 5OCC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	49 → 128	Immunoglobulin domain	Domain
  PF13895	Ig_2	132 → 214	Immunoglobulin domain	Domain

• Sequence:

  MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
  VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
  SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
  FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
  VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
  LEEPDDQNRI

• Sequence length: 310

Pathways

KEGG:

Virion - Ebolavirus, Lyssavirus and Morbillivirus
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia, Hemolytic	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autoimmune diseases	Autoimmune Diseases	rs41285370, rs869025224	10848805
Neutropenia	Neutropenia	rs879253882	10848805
Systemic lupus erythematosus	Systemic lupus erythematosus	rs77571059, rs10954213, rs2070197, rs72556554, rs3219018, rs121912990, rs1575496354, rs7574865, rs1307379746, rs758750492, rs1575497576

Unknown
Disease name	Disease term	dbSNP ID	References
Leukopenia	Leukopenia
Lupus erythematosus	Lupus Erythematosus, Systemic		12115230, 20385827, 23943494
Nephritis	Nephritis
Nonbacterial verrucal endocardiosis	Libman-Sacks Disease
Pericarditis	Pericarditis
Pleuritis	Pleurisy
Psychosis	Psychotic Disorders