Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
221150 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Spindle and kinetochore associated complex subunit 3 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
SKA3 |
SynonymsGene synonyms aliases
|
C13orf3, RAMA1 |
ChromosomeChromosome number
|
13 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
13q12.11 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromos |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8IX90 |
Protein name |
Spindle and kinetochore-associated protein 3 |
Protein function |
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:19289083, PubMed:19360002, PubMed:23085020). The SKA1 complex is a direct component of the kinet |
PDB |
4AJ5
|
Family and domains |
|
Sequence |
MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNI LLDKARLENQEGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSD PELSNCENFQKTDVKDDLSDPPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVN NYKEEPVIVTPPTKQSLVKVLKTPKCALKMDDFECVTPKLEHFGISEYTMCLNEDYTMGL KNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEYTNSPLVPTFCTPGLKIPSTK NSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPT PPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN
|
|
Sequence length |
412 |
Interactions |
View interactions |
Associated diseases
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Liver carcinoma |
Liver carcinoma |
|
28284560 |
|