FCER1G (Fc epsilon receptor Ig)

Gene

• Entrez ID: 2207
• Gene name: Fc epsilon receptor Ig
• Gene symbol: FCER1G
• Synonyms: FCRG
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054333	hsa-miR-1225-3p	Microarray, qRT-PCR	23593351
MIRT993751	hsa-miR-2110	CLIP-seq
MIRT993752	hsa-miR-3135b	CLIP-seq
MIRT993753	hsa-miR-4259	CLIP-seq
MIRT993754	hsa-miR-4271	CLIP-seq
MIRT993755	hsa-miR-4425	CLIP-seq
MIRT993756	hsa-miR-4653-3p	CLIP-seq
MIRT993757	hsa-miR-4725-3p	CLIP-seq
MIRT993758	hsa-miR-571	CLIP-seq
MIRT2228832	hsa-miR-3616-3p	CLIP-seq
MIRT2228833	hsa-miR-3652	CLIP-seq
MIRT2228834	hsa-miR-4430	CLIP-seq
MIRT2228835	hsa-miR-4446-3p	CLIP-seq
MIRT2228836	hsa-miR-4492	CLIP-seq
MIRT2228837	hsa-miR-4498	CLIP-seq
MIRT2228838	hsa-miR-4721	CLIP-seq
MIRT2228839	hsa-miR-548b-3p	CLIP-seq
MIRT2228840	hsa-miR-7	CLIP-seq
MIRT2228841	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002283	Process	Neutrophil activation involved in immune response	IBA	21873635
GO:0002292	Process	T cell differentiation involved in immune response	IBA	21873635
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8810294, 9280292, 16735691, 26311901, 29143175
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	16735691
GO:0007596	Process	Blood coagulation	TAS
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	IDA	1535625
GO:0010543	Process	Regulation of platelet activation	IBA	21873635
GO:0016064	Process	Immunoglobulin mediated immune response	IBA	21873635
GO:0019767	Function	IgE receptor activity	IBA	21873635
GO:0019863	Function	IgE binding	IEA
GO:0019864	Function	IgG binding	IBA	21873635
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031623	Process	Receptor internalization	ISS
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032998	Component	Fc-epsilon receptor I complex	IBA	21873635
GO:0038094	Process	Fc-gamma receptor signaling pathway	IBA	21873635
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IMP	16735691
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038156	Process	Interleukin-3-mediated signaling pathway	ISS
GO:0042590	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I	IBA	21873635
GO:0042742	Process	Defense response to bacterium	IBA	21873635
GO:0042802	Function	Identical protein binding	IDA	14967045
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0050766	Process	Positive regulation of phagocytosis	IBA	21873635
GO:0050900	Process	Leukocyte migration	TAS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

Other IDs

• MIM: 147139
• HGNC: 3611
• e!Ensembl: ENSG00000158869

Protein

• UniProt ID: P30273
• Protein name: High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
• Protein function: Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammat
• PDB: 7Q5T, 8YVU, 8YWA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11628	TCR_zetazeta	21 → 51	T-cell surface glycoprotein CD3 zeta chain	Family
  PF02189	ITAM	62 → 81	Immunoreceptor tyrosine-based activation motif	Motif

• Sequence:

  MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
  SDGVYTGLSTRNQETYETLKHEKPPQ

• Sequence length: 86

Pathways

KEGG:

Sphingolipid signaling pathway
Phospholipase D signaling pathway
Platelet activation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Tuberculosis
Asthma

Reactome:

GPVI-mediated activation cascade
Cell surface interactions at the vascular wall
Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation
Dectin-2 family
Neutrophil degranulation
Platelet Adhesion to exposed collagen

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma, Childhood asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	30929738, 31619474, 30929738

Unknown
Disease name	Disease term	dbSNP ID	References
Allergic rhinitis	Allergic rhinitis (disorder)		30013184
Eczema	Eczema		30595370