PTK2B (protein tyrosine kinase 2 beta)

Gene

• Entrez ID: 2185
• Gene name: Protein tyrosine kinase 2 beta
• Gene symbol: PTK2B
• Synonyms: CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
• Chromosome: 8
• Chromosome location: 8p21.2
• Summary: This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006963	hsa-miR-23b-3p	Immunoblot	22745829
MIRT018928	hsa-miR-335-5p	Microarray	18185580
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28262617
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28262617
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT1273554	hsa-miR-3189-5p	CLIP-seq
MIRT1273555	hsa-miR-3664-3p	CLIP-seq
MIRT1273556	hsa-miR-4433	CLIP-seq
MIRT1273557	hsa-miR-4459	CLIP-seq
MIRT1273558	hsa-miR-4469	CLIP-seq
MIRT1273559	hsa-miR-4726-3p	CLIP-seq
MIRT1273560	hsa-miR-4758-3p	CLIP-seq
MIRT1273561	hsa-miR-4768-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT1273563	hsa-miR-548a-5p	CLIP-seq
MIRT1273564	hsa-miR-548ab	CLIP-seq
MIRT1273565	hsa-miR-548ak	CLIP-seq
MIRT1273566	hsa-miR-548b-5p	CLIP-seq
MIRT1273567	hsa-miR-548c-5p	CLIP-seq
MIRT1273568	hsa-miR-548d-5p	CLIP-seq
MIRT1273569	hsa-miR-548h	CLIP-seq
MIRT1273570	hsa-miR-548i	CLIP-seq
MIRT1273571	hsa-miR-548j	CLIP-seq
MIRT1273572	hsa-miR-548w	CLIP-seq
MIRT1273573	hsa-miR-548y	CLIP-seq
MIRT1273574	hsa-miR-559	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080463	hsa-miR-517a	CLIP-seq
MIRT2080464	hsa-miR-517b	CLIP-seq
MIRT2080465	hsa-miR-517c	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2306603	hsa-miR-3607-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2306605	hsa-miR-4501	CLIP-seq
MIRT2306606	hsa-miR-4504	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2306608	hsa-miR-542-3p	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604315	hsa-miR-3125	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2604318	hsa-miR-3202	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604321	hsa-miR-3916	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604331	hsa-miR-4476	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604336	hsa-miR-4671-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2689055	hsa-miR-198	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2689056	hsa-miR-4267	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001525	Process	Angiogenesis	IBA	21873635
GO:0001556	Process	Oocyte maturation	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	18765415
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002315	Process	Marginal zone B cell differentiation	ISS
GO:0004683	Function	Calmodulin-dependent protein kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	TAS	8939945
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	7544443, 10518561
GO:0004972	Function	NMDA glutamate receptor activity	ISS
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8849729, 9020138, 10521452, 10867021, 11149930, 15661758, 18086875, 19086031, 21357692, 31413325, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	19880522
GO:0005737	Component	Cytoplasm	TAS	7499242
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0005925	Component	Focal adhesion	IDA	18765415
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	7529876
GO:0006915	Process	Apoptotic process	TAS	10880513
GO:0006968	Process	Cellular defense response	ISS
GO:0006970	Process	Response to osmotic stress	IEA
GO:0007165	Process	Signal transduction	TAS	7499242, 10867021
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	8849729
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007172	Process	Signal complex assembly	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	15050747
GO:0008022	Function	Protein C-terminus binding	IMP	10022914
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18765415
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	15050747
GO:0008360	Process	Regulation of cell shape	IMP	19086031
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010226	Process	Response to lithium ion	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	21245381
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	IEA
GO:0010752	Process	Regulation of cGMP-mediated signaling	IEA
GO:0010758	Process	Regulation of macrophage chemotaxis	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0014009	Process	Glial cell proliferation	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0014069	Component	Postsynaptic density	TAS	25707991
GO:0017146	Component	NMDA selective glutamate receptor complex	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7544443
GO:0030027	Component	Lamellipodium	IDA	18765415
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030155	Process	Regulation of cell adhesion	IBA	21873635
GO:0030155	Process	Regulation of cell adhesion	IMP	19086031
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18765415
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	ISS
GO:0030502	Process	Negative regulation of bone mineralization	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	18765415
GO:0031175	Process	Neuron projection development	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032960	Process	Regulation of inositol trisphosphate biosynthetic process	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	8670418
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0035902	Process	Response to immobilization stress	IEA
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	9545257, 10518561
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	ISS
GO:0038110	Process	Interleukin-2-mediated signaling pathway	TAS
GO:0042220	Process	Response to cocaine	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042976	Process	Activation of Janus kinase activity	IMP	8670418
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19880522
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043197	Component	Dendritic spine	IBA	21873635
GO:0043267	Process	Negative regulation of potassium ion transport	IDA	7544443
GO:0043423	Function	3-phosphoinositide-dependent protein kinase binding	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	ISS
GO:0044297	Component	Cell body	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045453	Process	Bone resorption	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IMP	15050747
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	7544443
GO:0046330	Process	Positive regulation of JNK cascade	IMP	8670418
GO:0046777	Process	Protein autophosphorylation	TAS	8849729
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	21245381
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048167	Process	Regulation of synaptic plasticity	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18765415
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10022914, 10518561, 21245381
GO:0050848	Process	Regulation of calcium-mediated signaling	IEA
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	ISS
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	10867021
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	7544443
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031
GO:0090630	Process	Activation of GTPase activity	IEA
GO:0097440	Component	Apical dendrite	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:2000058	Process	Regulation of ubiquitin-dependent protein catabolic process	IDA	19880522
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	ISS
GO:2000249	Process	Regulation of actin cytoskeleton reorganization	ISS
GO:2000310	Process	Regulation of NMDA receptor activity	ISS
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS
GO:2000538	Process	Positive regulation of B cell chemotaxis	ISS
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

Other IDs

• MIM: 601212
• HGNC: 9612
• e!Ensembl: ENSG00000120899

Protein

• UniProt ID: Q14289
• Protein name: Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine
• Protein function: Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading and bone remodeling. Plays a role in the regulation of the humoral immune response, and is requi
• PDB: 2LK4, 3CC6, 3ET7, 3FZO, 3FZP, 3FZR, 3FZS, 3FZT, 3GM1, 3GM2, 3GM3, 3H3C, 3U3F, 4EKU, 4H1J, 4H1M, 4R32, 4XEF, 4XEK, 4XEV, 5TO8, 5TOB, 6LF3, 7PLL, 8XOX, 8YGX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18038	FERM_N_2	39 → 137	FERM N-terminal domain	Domain
  PF00373	FERM_M	141 → 265	FERM central domain	Domain
  PF07714	PK_Tyr_Ser-Thr	425 → 679	Protein tyrosine and serine/threonine kinase	Domain
  PF03623	Focal_AT	870 → 1002	Focal adhesion targeting region	Domain

• Sequence:

  MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
  CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
  LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
  LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
  LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
  EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
  SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
  AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
  LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
  ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
  RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
  CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
  KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
  EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
  LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
  LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
  QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

• Sequence length: 1009

Pathways

KEGG:

Calcium signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
GnRH signaling pathway
Yersinia infection
Hepatitis B
Human cytomegalovirus infection
Human immunodeficiency virus 1 infection

Reactome:

Signal regulatory protein family interactions
VEGFA-VEGFR2 Pathway
Interleukin-2 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	24162737, 30617256, 31473137, 29777097
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	19718025

Unknown
Disease name	Disease term	dbSNP ID	References
Grand mal status epilepticus	Grand Mal Status Epilepticus		16600505
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		16600505
Petit mal status	Petit mal status		16600505
Skin cancer	Malignant neoplasm of skin		19718025
Skin neoplasms	Skin Neoplasms		19718025
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		16600505
Takayasu arteritis	Takayasu Arteritis		30498034