FABP4 (fatty acid binding protein 4)

Gene

• Entrez ID: 2167
• Gene name: Fatty acid binding protein 4
• Gene symbol: FABP4
• Synonyms: A-FABP, AFABP, ALBP, HEL-S-104, aP2
• Chromosome: 8
• Chromosome location: 8q21.13
• Summary: FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles inc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005490	hsa-miR-138-5p	qRT-PCR	20486779
MIRT005959	hsa-miR-369-5p	Luciferase reporter assay	21660946
MIRT019040	hsa-miR-335-5p	Microarray	18185580
MIRT005959	hsa-miR-369-5p	Reporter assay	21660946
MIRT736118	hsa-miR-455-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31638263
MIRT1548466	hsa-miR-935	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ASXL1	Unknown	21047783
FOXO1	Activation	20102700
PPARA	Unknown	19717768
PPARG	Activation	11574398
PPARG	Unknown	17322100;21047783

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transporter activity	ISS
GO:0005504	Function	Fatty acid binding	TAS	2481498
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005811	Component	Lipid droplet	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0015909	Process	Long-chain fatty acid transport	ISS
GO:0019433	Process	Triglyceride catabolic process	TAS
GO:0036041	Function	Long-chain fatty acid binding	ISS
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051427	Function	Hormone receptor binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24603714

Other IDs

• MIM: 600434
• HGNC: 3559
• e!Ensembl: ENSG00000170323

Protein

• UniProt ID: P15090
• Protein name: Fatty acid-binding protein, adipocyte (Adipocyte lipid-binding protein) (ALBP) (Adipocyte-type fatty acid-binding protein) (A-FABP) (AFABP) (Fatty acid-binding protein 4)
• Protein function: Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
• PDB: 1TOU, 1TOW, 2HNX, 2NNQ, 3FR2, 3FR4, 3FR5, 3P6C, 3P6D, 3P6E, 3P6F, 3P6G, 3P6H, 3Q6L, 3RZY, 4NNS, 4NNT, 5D45, 5D47, 5D48, 5D4A, 5EDB, 5EDC, 5HZ6, 5HZ8, 5Y0F, 5Y0G, 5Y0X, 5Y12, 5Y13, 6AYL, 6LJS, 6LJT, 6LJU, 6LJV, 6LJW, 6LJX, 7FVU, 7FVV, 7FVW, 7FVX, 7FVY, 7FVZ, 7FW0, 7FW1, 7FW2, 7FW3, 7FW4, 7FW5, 7FW6, 7FW7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	6 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Sequence:

  MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
  TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
  KGVTSTRVYERA

• Sequence length: 132

Pathways

KEGG:

PPAR signaling pathway
Regulation of lipolysis in adipocytes

Reactome:

Triglyceride catabolism
Transcriptional regulation of white adipocyte differentiation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	16316942
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	30215792

Unknown
Disease name	Disease term	dbSNP ID	References
Anaplastic carcinoma	Anaplastic carcinoma		16316942