GediPNet logo

ABCD1 (ATP binding cassette subfamily D member 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
215
Gene nameGene Name - the full gene name approved by the HGNC.
ATP binding cassette subfamily D member 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
ABCD1
SynonymsGene synonyms aliases
ABC42, ALD, ALDP, AMN
ChromosomeChromosome number
X
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs4010613 C>A,T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs11146842 G>A Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs128624214 C>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs128624215 C>G,T Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs128624219 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029416 hsa-miR-26b-5p Microarray 19088304
MIRT050424 hsa-miR-23a-3p CLASH 23622248
MIRT039787 hsa-miR-615-3p CLASH 23622248
MIRT053394 hsa-miR-96-5p Microarray 23807165
MIRT758715 hsa-miR-1202 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002082 Process Regulation of oxidative phosphorylation ISS
GO:0005324 Function Long-chain fatty acid transporter activity EXP 11500517
GO:0005324 Function Long-chain fatty acid transporter activity IBA 21873635
GO:0005324 Function Long-chain fatty acid transporter activity IGI 18757502
GO:0005515 Function Protein binding IPI 10551832, 10777694, 11883941, 17609205, 20531392
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P33897
Protein name ATP-binding cassette sub-family D member 1 (EC 3.1.2.-) (EC 7.6.2.-) (Adrenoleukodystrophy protein) (ALDP)
Protein function ATP-dependent transporter of the ATP-binding cassette (ABC) family involved in the transport of very long chain fatty acid (VLCFA)-CoA from the cytosol to the peroxisome lumen (PubMed:11248239, PubMed:15682271, PubMed:16946495, PubMed:18757502,
PDB 7RR9 , 7RRA , 7SHM , 7SHN , 7VR1 , 7VWC , 7VX8 , 7VZB , 7X07 , 7X0T , 7X0Z , 7X1W , 7XEC , 7YRQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06472 ABC_membrane_2
78 352
ABC transporter transmembrane region 2
Family
PF00005 ABC_tran
490 633
ABC transporter
Domain
Sequence
MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGV
AAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLAR
CIVRKDPRAFGWQLLQWLLIALPATFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTY
YRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGT
AWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE
VELALLQRSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPII
TATGYSES
DAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVH
EMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIP
IVTPSGEVVVASLNIRVEEGMHLLITGPNGCGKSSLFRILGGLWPTYGGVLYKPPPQRMF
YIPQRPYMSVGSLRDQVIYPDSVEDMQRKGYSEQDLEAILDVVHLHHILQREGGWEAMCD
WKDVLSGGEKQRIGMARMFYHRPKYALLDECTS
AVSIDVEGKIFQAAKDAGIALLSITHR
PSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQRRLQELCQIL
GEAVAPAHVPAPSPQGPGGLQGAST
Sequence length 745
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  ABC transporters
Peroxisome
  ABC transporters in lipid homeostasis
Linoleic acid (LA) metabolism
alpha-linolenic acid (ALA) metabolism
Beta-oxidation of very long chain fatty acids
Defective ABCD1 causes adrenoleukodystrophy (ALD)
Class I peroxisomal membrane protein import
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Adrenoleukodystrophy Adrenoleukodystrophy rs128624213, rs128624214, rs1569541109, rs128624215, rs128624216, rs128624217, rs128624218, rs128624219, rs128624220, rs128624221, rs387906494, rs128624222, rs128624223, rs387906495, rs128624224, rs1569541096, rs2147483647, rs128624225, rs11146842, rs4010613, rs387906496, rs1569541198, rs1569540743, rs387906497, rs193922093, rs193922097, rs193922098, rs398123100, rs398123102, rs398123105, rs398123106, rs398123107, rs398123108, rs398123110, rs398123111, rs398123112, rs713993050, rs201568579, rs150346282, rs797044610, rs797044625, rs797044726, rs864309520, rs886044777, rs1057516052, rs1057517954, rs1064793877, rs1131691916, rs1131691743, rs1557054318, rs1557054153, rs1557052302, rs1557052362, rs1557054873, rs1557055340, rs1557052530, rs1557055392, rs1557052171, rs1557054875, rs1557052294, rs1557052390, rs1557052397, rs1557054210, rs1170974058, rs727503786, rs1557055405, rs1557055311, rs1557052555, rs1557052133, rs1159943880, rs1557054776, rs1557052351, rs1557055253, rs1557055398, rs1557052573, rs1557055260, rs1292006620, rs1569540693, rs782266592, rs1557055316, rs1569540676, rs1569541115, rs1569541000, rs1569541088, rs1569541203, rs1569540688, rs1569540883, rs1569541009, rs1569540665, rs1569540695, rs1569540704, rs1569541006, rs781862879, rs1557055337, rs1569541207, rs1603235321, rs1603231653, rs1603231784, rs1603231897, rs1603232111, rs1603232195, rs1603232243, rs1603233089, rs1603233113, rs1603234451, rs1603234759, rs1603235901, rs1603236012, rs1603235263, rs1603235389, rs1603231911, rs1603233120, rs1603234501, rs1603236020, rs1603231848, rs1603232237, rs1603234466, rs1603235267, rs1603235421, rs1603235941, rs1603234574, rs1603236013, rs2091702389, rs2091711094, rs2091711370, rs782509393, rs2091726671, rs2091726809, rs1557054173, rs2091749146, rs2091762383, rs2091763089, rs2091764526, rs2091764754, rs2091774046, rs2091775068, rs2091727061, rs2091708827, rs2091774163, rs2091726242 21488864, 15284851, 16023551, 15564782, 8566952, 27604308, 15643618, 17542813, 21700483, 21889498, 22366764, 9452087, 15800013, 24722136, 15811009, 14713218, 11336405, 24719134, 9051655, 24357685, 11220738, 7849723, 9088111, 7668254, 17029209, 7904210, 27084228, 11748843, 11248239, 23419472, 9242200, 8040304, 11810273, 10980539, 6795626, 19129531, 22483867, 15388659, 20661612, 7825602, 10737980, 22479560, 24154795, 11438993, 7878038, 15192815, 7581394, 8353949, 9195223, 7894167, 20455653, 10190819, 7717396, 26227820, 21966424, 16949688, 23300730, 16415970, 18973459, 10369742, 7998779, 24685009, 9894883, 23651979, 24480483, 16087056, 17285533, 10227685, 14767898, 8773611, 12913200, 22280810, 11798073, 10815658, 7860075, 10480364, 20626745, 10980309, 10551832, 23154058, 25324868, 7202134, 23566833, 28503596, 16401743, 11310629, 7677014, 17602313, 23664929, 8651290, 11102997, 21476988, 23712774, 23768953, 27067449, 24788897, 23835273, 23671276, 23430809, 23926373, 26454440, 26388597, 9553942, 8892025, 9556301, 21300044, 15812458, 8048932, 20195870, 1481812, 22198747, 22057157, 16319717, 21586746, 25655951, 7811247, 20008255, 17372139, 26686776, 21478203, 12175782, 8441467, 21068741, 9425230, 6728562, 23566848
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 9452087
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs120074176, rs786205019
Developmental regression Developmental regression rs1224421127
Unknown
Disease name Disease term dbSNP ID References
Addison`s disease Addison Disease
Adrenomyeloneuropathy Adrenomyeloneuropathy 21700483, 15811009, 7668254, 16319717, 8651290, 7878038, 22057157, 17602313
Alopecia Alopecia
Bowel incontinence Fecal Incontinence

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412