GediPNet logo

ERG (ETS transcription factor ERG)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2078
Gene nameGene Name - the full gene name approved by the HGNC.
ETS transcription factor ERG
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
ERG
SynonymsGene synonyms aliases
LMPHM14, erg-3, p55
ChromosomeChromosome number
21
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apo
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007094 hsa-miR-145-5p Luciferase reporter assay 23480797
MIRT016692 hsa-miR-133b Reporter assay 17344217
MIRT053340 hsa-miR-30a-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23728339
MIRT053340 hsa-miR-30a-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23728339
MIRT053341 hsa-miR-30b-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23728339
Transcription factors
Transcription factor Regulation Reference
ERG Activation 21536859
ETS1 Activation 7731694
ETS2 Activation 7731694
FLI1 Activation 21536859
GATA3 Activation 21536859
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 23093599
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IMP 18195090
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P11308
Protein name Transcriptional regulator ERG (Transforming protein ERG)
Protein function Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
PDB 1SXE , 4IRG , 4IRH , 4IRI , 5YBC , 5YBD , 6VGE , 6VGG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02198 SAM_PNT
122 205
Sterile alpha motif (SAM)/Pointed domain
Domain
PF00178 Ets
319 398
Ets-domain
Domain
Sequence
MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTS
DDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEA
TQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQA
LQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY
Sequence length 479
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Transcriptional misregulation in cancer
Prostate cancer
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Aortic aneurysm Aortic Aneurysm, Abdominal rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953, rs794728021, rs8046180, rs797045725, rs876657852, rs878854466, rs886038978, rs746972765, rs886039303, rs886040965, rs886040966, rs886040967, rs886229659, rs1553781304, rs1060502531, rs1553795301, rs1553803235, rs1213452826, rs869025352, rs1553780501, rs1553785222, rs1382893400, rs1554841990, rs1430822242, rs1567692384, rs1576422965, rs1596712899, rs2059732940, rs2041090817, rs1439991530 27899403
Autism Autistic Disorder rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634 22843504
Leukemia leukemia, Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601 19108891, 19822134
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591 27776115
Unknown
Disease name Disease term dbSNP ID References
Ewing sarcoma Ewings sarcoma
Extra-osseous ewing`s sarcoma Extra-osseous Ewing`s sarcoma 11823984
Extraskeletal ewing sarcoma Extraskeletal Ewing sarcoma
Knee osteoarthritis Osteoarthritis, Knee 30664745

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412