HTR3D (5-hydroxytryptamine receptor 3D)

Gene

• Entrez ID: 200909
• Gene name: 5-hydroxytryptamine receptor 3D
• Gene symbol: HTR3D
• Synonyms: 5HT3D
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: The protein encoded this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit D of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a mitogen and a ho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1057259	hsa-miR-3151	CLIP-seq
MIRT1057260	hsa-miR-3689a-3p	CLIP-seq
MIRT1057261	hsa-miR-3689c	CLIP-seq
MIRT1057262	hsa-miR-4283	CLIP-seq
MIRT1057263	hsa-miR-4446-3p	CLIP-seq
MIRT1057264	hsa-miR-4481	CLIP-seq
MIRT1057265	hsa-miR-4489	CLIP-seq
MIRT1057266	hsa-miR-4656	CLIP-seq
MIRT1057267	hsa-miR-4721	CLIP-seq
MIRT1057268	hsa-miR-4728-5p	CLIP-seq
MIRT1057269	hsa-miR-4745-5p	CLIP-seq
MIRT1057270	hsa-miR-4758-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IBA	21873635
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IDA	17392525
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0045202	Component	Synapse	IBA	21873635
GO:0050877	Process	Nervous system process	IBA	21873635

Other IDs

• MIM: 610122
• HGNC: 24004
• e!Ensembl: ENSG00000186090

Protein

• UniProt ID: Q70Z44
• Protein name: 5-hydroxytryptamine receptor 3D (5-HT3-D) (5-HT3D) (Serotonin receptor 3D)
• Protein function: Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	44 → 151	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	236 → 431	Neurotransmitter-gated ion-channel transmembrane region	Family

• Sequence:

  MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
  VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
  DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
  FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
  GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
  QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
  TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
  LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT

• Sequence length: 454

Pathways

KEGG:

Serotonergic synapse
Taste transduction

Reactome:

Neurotransmitter receptors and postsynaptic signal transmission

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20356718