Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
200298 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Long intergenic non-protein coding RNA 528 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
LINC00528 |
SynonymsGene synonyms aliases
|
C22orf37 |
ChromosomeChromosome number
|
22 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
22q11.21 |
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8N1L1 |
Protein name |
Putative uncharacterized protein encoded by LINC00528 |
Family and domains |
|
Sequence |
MALLLSDWCPDGDADTHTGTDPGRTTHRLCARERGVRGTQPCPRIYLRLPAQNCEETRFC CASPGSVVLGHGAPRTASPPSALSHPSPLEGLSFSPFPPSVLSHPSPPEGLSFSLFHCLC SGKLSESPGCFWNSLGWSFSVLTEPGVWKVGEAIWVAENLAQPLTSPCAC
|
|
Sequence length |
170 |
Interactions |
View interactions |
Associated diseases
|
|