Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
197196 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Long intergenic non-protein coding RNA 311 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
LINC00311 |
SynonymsGene synonyms aliases
|
NCRNA00311, TMEM148 |
ChromosomeChromosome number
|
16 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
16q24.1 |
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8N616 |
Protein name |
Putative uncharacterized protein encoded by LINC00311 |
Family and domains |
|
Sequence |
MVAADQGRGWNPLDGPTWEVLAMPLPLGPATQVPALFSAALVPPVSSLRPNQMLDWQRLK TPHGAPVACSLGLSGEWVPTPCALSILALLGLQLDPLFGLWGCTRTLFWSEWARESRRP
|
|
Sequence length |
119 |
Interactions |
View interactions |
Associated diseases
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Alopecia |
Alopecia |
|
28196072 |
|