GediPNet logo

EIF2S1 (eukaryotic translation initiation factor 2 subunit alpha)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1965
Gene nameGene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 2 subunit alpha
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
EIF2S1
SynonymsGene synonyms aliases
EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
ChromosomeChromosome number
14
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q23.3
SummarySummary of gene provided in NCBI Entrez Gene.
The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004813 hsa-miR-21-5p Quantitative proteomic approach 19253296
MIRT019778 hsa-miR-375 Microarray 20215506
MIRT026383 hsa-miR-192-5p Sequencing 20371350
MIRT046815 hsa-miR-222-3p CLASH 23622248
MIRT070854 hsa-miR-520f-3p HITS-CLIP 23824327
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003743 Function Translation initiation factor activity IBA 21873635
GO:0003743 Function Translation initiation factor activity IDA 16289705
GO:0005515 Function Protein binding IPI 9431994, 11500362, 16288713, 16932749, 17894550, 18596238, 18971339, 22323517, 25393282, 28514442, 32296183
GO:0005634 Component Nucleus IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P05198
Protein name Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF-2-alpha) (eIF-2A) (eIF-2alpha) (eIF2-alpha)
Protein function Member of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA (PubMed:16289705, PubMed:38340717). This complex binds to a 40S ribosomal subunit, followed by mRNA bindin
PDB 1KL9 , 1Q8K , 6K71 , 6K72 , 6O81 , 6O85 , 6O9Z , 6YBV , 6ZMW , 6ZP4 , 7A09 , 7D43 , 7D44 , 7D45 , 7F66 , 7F67 , 7NZM , 7QP6 , 7QP7 , 7SYR , 7SYS , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PPL , 8QZZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00575 S1
14 88
S1 RNA binding domain
Domain
PF07541 EIF_2_alpha
130 244
Eukaryotic translation initiation factor 2 alpha subunit
Family
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKR
RVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLER
TEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Sequence length 315
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Hepatitis C
Measles
Influenza A
Herpes simplex virus 1 infection
Lipid and atherosclerosis
  L13a-mediated translational silencing of Ceruloplasmin expression
PERK regulates gene expression
ABC-family proteins mediated transport
Translation initiation complex formation
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Recycling of eIF2:GDP
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316 17406652
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 19834500
Unknown
Disease name Disease term dbSNP ID References
Cognitive disorder Cognition Disorders 17406652
Grand mal status epilepticus Grand Mal Status Epilepticus 15003282
Nonconvulsive status epilepticus Non-Convulsive Status Epilepticus 15003282
Osteosarcoma Osteosarcoma 14767549

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412