EGR4 (early growth response 4)

Gene

• Entrez ID: 1961
• Gene name: Early growth response 4
• Gene symbol: EGR4
• Synonyms: AT133, NGFI-C, NGFIC, PAT133
• Chromosome: 2
• Chromosome location: 2p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT955319	hsa-miR-138	CLIP-seq
MIRT955320	hsa-miR-3907	CLIP-seq
MIRT955321	hsa-miR-4471	CLIP-seq
MIRT955322	hsa-miR-4487	CLIP-seq
MIRT955323	hsa-miR-548q	CLIP-seq
MIRT955319	hsa-miR-138	CLIP-seq
MIRT955320	hsa-miR-3907	CLIP-seq
MIRT955321	hsa-miR-4471	CLIP-seq
MIRT955322	hsa-miR-4487	CLIP-seq
MIRT955323	hsa-miR-548q	CLIP-seq
MIRT955319	hsa-miR-138	CLIP-seq
MIRT955320	hsa-miR-3907	CLIP-seq
MIRT955321	hsa-miR-4471	CLIP-seq
MIRT955322	hsa-miR-4487	CLIP-seq
MIRT955323	hsa-miR-548q	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12560487
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1584812
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1658795
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12560487
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 128992
• HGNC: 3241
• e!Ensembl: ENSG00000135625

Protein

• UniProt ID: Q05215
• Protein name: Early growth response protein 4 (EGR-4) (AT133)
• Protein function: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCGGGGGCG-3' (GSG). Activates the transcription of target genes whose products are required for mitogenesis and differentiation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	483 → 507	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	513 → 535	Zinc finger, C2H2 type	Domain

• Sequence:

  MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPRLPDSFPRGEC
  PKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKS
  TEGCCAEPSAELPRLPARDAPAATGYPGAGDFLSWALNSCGASGDLADSCFLEGPAPTPP
  PGLSYSGSFFIQAVPEHPHDPEALFNLMSGILGLAPFPGPEAAASRSPLDAPFPAGSDAL
  LPGPPDLYSPDLGAAPFPEAFWEASPCAGAPSQCLYEPQLSPPDVKPGLRAPPASPALDA
  VSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPA
  NRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLR
  SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHA
  KAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKP
  FACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL

• Sequence length: 589

Pathways

Reactome:

NGF-stimulated transcription

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	17360599, 22691714