GediPNet logo

EGR1 (early growth response 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1958
Gene nameGene Name - the full gene name approved by the HGNC.
Early growth response 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
EGR1
SynonymsGene synonyms aliases
AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZIF268, ZNF225
ChromosomeChromosome number
5
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004130 hsa-miR-192-5p Microarray 16822819
MIRT006540 hsa-miR-183-5p Luciferase reporter assay 21118966
MIRT006540 hsa-miR-183-5p Luciferase reporter assay 21118966
MIRT023192 hsa-miR-124-3p Microarray 18668037
MIRT024271 hsa-miR-215-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
ATF5 Unknown 19531563
BRCA1 Unknown 20103632
ETS1 Activation 19074849
ETS1 Unknown 9207063
ETS2 Unknown 9207063
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IDA 19307576
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 18718911
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 14979875, 19307576
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P18146
Protein name Early growth response protein 1 (EGR-1) (AT225) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24)
Protein function Transcriptional regulator (PubMed:20121949). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (By similarity). Binds double-stranded target DNA, irrespective of the cytosine methylatio
PDB 4R2A , 4R2C , 4R2D , 4X9J , 5N14
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11928 DUF3446
135 219
Early growth response N-terminal domain
Domain
PF00096 zf-C2H2
338 362
Zinc finger, C2H2 type
Domain
PF00096 zf-C2H2
368 390
Zinc finger, C2H2 type
Domain
PF00096 zf-C2H2
396 418
Zinc finger, C2H2 type
Domain
PF11914 DUF3432
424 462
Domain of unknown function (DUF3432)
Repeat
PF11914 DUF3432
452 530
Domain of unknown function (DUF3432)
Repeat
Sequence
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPE
PQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSD
MTATFSPRTI
EIC
Sequence length 543
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Apelin signaling pathway
GnRH signaling pathway
Parathyroid hormone synthesis, secretion and action
AGE-RAGE signaling pathway in diabetic complications
Prion disease
Human T-cell leukemia virus 1 infection
  Regulation of PTEN gene transcription
NGF-stimulated transcription
Interferon alpha/beta signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Autoimmune diseases Autoimmune Diseases rs41285370, rs869025224 25055964
Cholestasis Cholestasis rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 21224055
Intrahepatic cholestasis Intrahepatic Cholestasis rs121918299, rs80338722, rs80338725, rs80338719, rs80338723, rs80338726, rs72549401, rs11568372, rs1553469602, rs387907317, rs387906354, rs752919965, rs72549397, rs111033609, rs121909099, rs387906381, rs121909100, rs121909101, rs121909104, rs121909105, rs387906526, rs121918440, rs387906527, rs72552778, rs387906529, rs121918443, rs72552780, rs80338724, rs80338715, rs80338727, rs80338729, rs80338716, rs80338717, rs398122839, rs515726137, rs587777519, rs587777520, rs587777521, rs879255644, rs113090017, rs864321695, rs776869985, rs864321697, rs80338720, rs746155190, rs879255504, rs886041948, rs886042562, rs769910565, rs758069019, rs886043807, rs72549402, rs72549395, rs188824058, rs763782349, rs375315619, rs754287486, rs1057518679, rs1060499649, rs1060499579, rs1554660803, rs1554407511, rs774824767, rs771690686, rs752992432, rs1553466082, rs72549396, rs772294884, rs764513998, rs1202682161, rs759202962, rs1562774655, rs1562831765, rs1562945221, rs917981474, rs1558927163, rs765889649, rs1562976061, rs72549399, rs1459273753, rs377160065, rs1559183717, rs760750012, rs1051861187, rs1558898789, rs928915940, rs752757689, rs1584678508, rs764581483, rs1574453508, rs751511532, rs1182781290, rs376368459, rs762702807, rs1578499691, rs199791850, rs1452792080, rs1458423947, rs1584747270, rs1584750653, rs1599066459, rs1599069873, rs1599166106, rs1574462504, rs1593114820, rs1057524081, rs1588081022, rs777460754, rs1251192873, rs1588117076, rs748671901, rs139314808, rs749009273, rs1588080674, rs1588080680, rs1588127136, rs1588135086, rs757693457, rs1574445178, rs768922690, rs1584422832, rs1584433525, rs1312396424, rs1792048079, rs774411820, rs575729461 22094456, 18364083
Unknown
Disease name Disease term dbSNP ID References
Cerebral ischemia Brain Ischemia 17394460
Cholangitis Cholangitis 25055964
Hydronephrosis Hydronephrosis 25015655
Juvenile arthritis Juvenile psoriatic arthritis 19565504

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412