GediPNet logo

EFNB2 (ephrin B2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1948
Gene nameGene Name - the full gene name approved by the HGNC.
Ephrin B2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
EFNB2
SynonymsGene synonyms aliases
EPLG5, HTKL, Htk-L, LERK5, ephrin-B2
ChromosomeChromosome number
13
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q33.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT007101 hsa-miR-204-5p Luciferase reporter assay, qRT-PCR, Western blot 23204229
MIRT007101 hsa-miR-204-5p Luciferase reporter assay, qRT-PCR, Western blot 23204229
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0002042 Process Cell migration involved in sprouting angiogenesis IDA 12734395
GO:0005515 Function Protein binding IPI 12606549, 15764601, 18488039, 19836338, 26481148, 28514442, 28904190, 32296183
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005886 Component Plasma membrane IDA 17251577, 28931592
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P52799
Protein name Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)
Protein function Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing o
PDB 2HLE , 2I85 , 2VSK , 2VSM , 2WO2 , 3GXU , 4UF7 , 6P7Y , 6PDL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin
29 164
Ephrin
Domain
Sequence
MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKV
GQDASSAGSTRNKDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Sequence length 333
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Axon guidance   EPH-Ephrin signaling
EPHB-mediated forward signaling
Ephrin signaling
EPH-ephrin mediated repulsion of cells
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 27935865
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 20483485
Unknown
Disease name Disease term dbSNP ID References
Congenital lung agenesis Congenital absence of lung 30106123
Liver neoplasms Liver neoplasms 19233941
Liver cancer Malignant neoplasm of liver 19233941
Lung agenesis Unilateral lung agenesis 30106123

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412