Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
192668 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Cystin 1 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
CYS1 |
SynonymsGene synonyms aliases
|
- |
ChromosomeChromosome number
|
2 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
2p25.1 |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q717R9 |
Protein name |
Cystin-1 (Cilia-associated protein) |
Family and domains |
|
Sequence |
MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSP VAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSG NVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR
|
|
Sequence length |
158 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Bronchitis |
Bronchitis, Chronic |
|
25241909 |
|