GediPNet logo

HIGD2A (HIG1 hypoxia inducible domain family member 2A)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
192286
Gene nameGene Name - the full gene name approved by the HGNC.
HIG1 hypoxia inducible domain family member 2A
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
HIGD2A
SynonymsGene synonyms aliases
HIG2A, RCF1b
ChromosomeChromosome number
5
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholo
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT256742 hsa-miR-181a-5p HITS-CLIP 22473208
MIRT256743 hsa-miR-181b-5p HITS-CLIP 22473208
MIRT256744 hsa-miR-181c-5p HITS-CLIP 22473208
MIRT256746 hsa-miR-181d-5p HITS-CLIP 22473208
MIRT1046028 hsa-miR-1273g CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0016021 Component Integral component of membrane IEA
GO:0043066 Process Negative regulation of apoptotic process IDA 21856340
GO:0070469 Component Respirasome IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9BW72
Protein name HIG1 domain family member 2A, mitochondrial (RCF1 homolog B) (RCF1b)
Protein function Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04588 HIG_1_N
45 96
Hypoxia induced protein conserved region
Family
Sequence
MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAAL
TYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLG
LAVTAMKSRP
Sequence length 106
Interactions View interactions
Associated diseases
Unknown
Disease name Disease term dbSNP ID References
Liver neoplasms Liver neoplasms 19233941
Liver cancer Malignant neoplasm of liver 19233941

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412