GediPNet logo

E2F6 (E2F transcription factor 6)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1876
Gene nameGene Name - the full gene name approved by the HGNC.
E2F transcription factor 6
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
E2F6
SynonymsGene synonyms aliases
E2F-6
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of transcription factors that play a crucial role in the control of the cell cycle. The protein encoded by this gene lacks the transactivation and tumor suppressor protein association domains found in other family me
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004726 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19843643
MIRT004726 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19843643
MIRT004726 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19843643
MIRT004726 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19843643
MIRT005044 hsa-let-7b-5p Microarray 17699775
Transcription factors
Transcription factor Regulation Reference
BRCA1 Repression 17096023
E2F1 Activation 16107498
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 9501179
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9501179
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O75461
Protein name Transcription factor E2F6 (E2F-6)
Protein function Inhibitor of E2F-dependent transcription (PubMed:9501179, PubMed:9689056, PubMed:9704927). Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' (PubMed:9501179). Has a preference for the 5'-TTTCCCGC-3' E2F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02319 E2F_TDP
64 128
E2F/DP family winged-helix DNA-binding domain
Domain
PF16421 E2F_CC-MB
143 237
E2F transcription factor CC-MB domain
Domain
Sequence
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS
KNHIRWIG
SDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL
AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCE
VEQ
GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN
Sequence length 281
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Polycomb repressive complex   G1/S-Specific Transcription
Transcriptional Regulation by E2F6
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193 29754146

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412