DUSP9 (dual specificity phosphatase 9)

Gene

• Entrez ID: 1852
• Gene name: Dual specificity phosphatase 9
• Gene symbol: DUSP9
• Synonyms: MKP-4, MKP4
• Chromosome: X
• Chromosome location: Xq28
• Summary: The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027506	hsa-miR-98-5p	Microarray	19088304
MIRT494020	hsa-miR-1321	PAR-CLIP	23592263
MIRT494021	hsa-miR-4739	PAR-CLIP	23592263
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494018	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT494017	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT494016	hsa-miR-4270	PAR-CLIP	23592263
MIRT494015	hsa-miR-4441	PAR-CLIP	23592263
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT494013	hsa-miR-7706	PAR-CLIP	23592263
MIRT494012	hsa-miR-7515	PAR-CLIP	23592263
MIRT494011	hsa-miR-3179	PAR-CLIP	23592263
MIRT494009	hsa-miR-3197	PAR-CLIP	23592263
MIRT494010	hsa-miR-4271	PAR-CLIP	23592263
MIRT494008	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT494007	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT494006	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494005	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT494020	hsa-miR-1321	PAR-CLIP	27292025
MIRT494020	hsa-miR-1321	PAR-CLIP	27292025
MIRT494016	hsa-miR-4270	PAR-CLIP	27292025
MIRT494016	hsa-miR-4270	PAR-CLIP	27292025
MIRT494015	hsa-miR-4441	PAR-CLIP	27292025
MIRT494015	hsa-miR-4441	PAR-CLIP	27292025
MIRT494021	hsa-miR-4739	PAR-CLIP	27292025
MIRT494021	hsa-miR-4739	PAR-CLIP	27292025
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT494020	hsa-miR-1321	PAR-CLIP	23592263
MIRT494021	hsa-miR-4739	PAR-CLIP	23592263
MIRT494019	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494018	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT494017	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT494016	hsa-miR-4270	PAR-CLIP	23592263
MIRT494015	hsa-miR-4441	PAR-CLIP	23592263
MIRT494014	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT494013	hsa-miR-7706	PAR-CLIP	23592263
MIRT494012	hsa-miR-7515	PAR-CLIP	23592263
MIRT494011	hsa-miR-3179	PAR-CLIP	23592263
MIRT494009	hsa-miR-3197	PAR-CLIP	23592263
MIRT494010	hsa-miR-4271	PAR-CLIP	23592263
MIRT494008	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT494007	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT494006	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494005	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT948390	hsa-miR-1252	CLIP-seq
MIRT948391	hsa-miR-186	CLIP-seq
MIRT948392	hsa-miR-3133	CLIP-seq
MIRT948393	hsa-miR-4504	CLIP-seq
MIRT948394	hsa-miR-452	CLIP-seq
MIRT948395	hsa-miR-4676-3p	CLIP-seq
MIRT948396	hsa-miR-4731-3p	CLIP-seq
MIRT948397	hsa-miR-4801	CLIP-seq
MIRT948398	hsa-miR-549	CLIP-seq
MIRT1548079	hsa-miR-3921	CLIP-seq
MIRT1548080	hsa-miR-4251	CLIP-seq
MIRT1548081	hsa-miR-4279	CLIP-seq
MIRT1548082	hsa-miR-4329	CLIP-seq
MIRT1548083	hsa-miR-4653-5p	CLIP-seq
MIRT1548084	hsa-miR-4786-5p	CLIP-seq
MIRT1548085	hsa-miR-769-5p	CLIP-seq
MIRT1981003	hsa-miR-1184	CLIP-seq
MIRT1981004	hsa-miR-1301	CLIP-seq
MIRT1981005	hsa-miR-3127-3p	CLIP-seq
MIRT1981006	hsa-miR-3138	CLIP-seq
MIRT1981007	hsa-miR-328	CLIP-seq
MIRT1981008	hsa-miR-3911	CLIP-seq
MIRT1981009	hsa-miR-4258	CLIP-seq
MIRT1981010	hsa-miR-4453	CLIP-seq
MIRT1981011	hsa-miR-4520a-3p	CLIP-seq
MIRT1981012	hsa-miR-4538	CLIP-seq
MIRT1981013	hsa-miR-4660	CLIP-seq
MIRT1981014	hsa-miR-4800-5p	CLIP-seq
MIRT1981015	hsa-miR-5047	CLIP-seq
MIRT2216133	hsa-miR-615-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000188	Process	Inactivation of MAPK activity	IBA	21873635
GO:0004721	Function	Phosphoprotein phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	11988087, 21908610, 31980649
GO:0005634	Component	Nucleus	TAS	9030581
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0007254	Process	JNK cascade	TAS	9030581
GO:0008330	Function	Protein tyrosine/threonine phosphatase activity	IBA	21873635
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	21873635
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IBA	21873635
GO:0035970	Process	Peptidyl-threonine dephosphorylation	IBA	21873635
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0051019	Function	Mitogen-activated protein kinase binding	IBA	21873635
GO:0060420	Process	Regulation of heart growth	IBA	21873635
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA

Other IDs

• MIM: 300134
• HGNC: 3076
• e!Ensembl: ENSG00000130829

Protein

• UniProt ID: Q99956
• Protein name: Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP-4)
• Protein function: Inactivates MAP kinases. Has a specificity for the ERK family.
• PDB: 2HXP, 3LJ8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00581	Rhodanese	7 → 133	Rhodanese-like domain	Domain
  PF00782	DSPc	211 → 343	Dual specificity phosphatase, catalytic domain	Domain

• Sequence:

  MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
  VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
  YYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADR
  DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
  PNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
  TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
  SAASNPPSFFTTPTSDGAFELAPT

• Sequence length: 384

Pathways

KEGG:

MAPK signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

RAF-independent MAPK1/3 activation
Negative regulation of MAPK pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	30718926