GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

DUSP1 (dual specificity phosphatase 1)

Gene

1843

Dual specificity phosphatase 1

DUSP1

CL100, HVH1, MKP-1, MKP1, PTPN10

5q35.1

The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play

Show/Hide all(380)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005876	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21068409
MIRT005876	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21068409
MIRT028795	hsa-miR-26b-5p	Microarray	19088304
MIRT053465	hsa-miR-200c-3p	Microarray	23807165
MIRT438558	hsa-miR-146a-5p	qRT-PCR, Western blot	23825193
MIRT437985	hsa-miR-940	qRT-PCR, Microarray, Western blot	24675421
MIRT438558	hsa-miR-146a-5p	qRT-PCR, Western blot	23825193
MIRT437985	hsa-miR-940	qRT-PCR, Microarray, Western blot	24675421
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT548539	hsa-miR-4500	PAR-CLIP	21572407
MIRT548538	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548537	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548536	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548535	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548534	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548533	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548532	hsa-miR-4458	PAR-CLIP	21572407
MIRT548531	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548530	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548529	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548528	hsa-miR-4678	PAR-CLIP	21572407
MIRT548527	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT548526	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548525	hsa-miR-182-3p	PAR-CLIP	21572407
MIRT548524	hsa-miR-597-3p	PAR-CLIP	21572407
MIRT548523	hsa-miR-152-5p	PAR-CLIP	21572407
MIRT548522	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548521	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT548520	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT548519	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT548518	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT053465	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	27696308
MIRT733967	hsa-miR-1468-3p	Flow cytometry, Luciferase reporter assay, RNA-seq, qRT-PCR, Western blotting	32348937
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT548539	hsa-miR-4500	PAR-CLIP	21572407
MIRT548538	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548537	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548536	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548535	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548534	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548533	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548532	hsa-miR-4458	PAR-CLIP	21572407
MIRT548531	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548530	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548529	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548528	hsa-miR-4678	PAR-CLIP	21572407
MIRT548527	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT548526	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548525	hsa-miR-182-3p	PAR-CLIP	21572407
MIRT548524	hsa-miR-597-3p	PAR-CLIP	21572407
MIRT548523	hsa-miR-152-5p	PAR-CLIP	21572407
MIRT548522	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548521	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT548520	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT548519	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT548518	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947381	hsa-miR-1289	CLIP-seq
MIRT947382	hsa-miR-137	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947388	hsa-miR-203	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947390	hsa-miR-25	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947392	hsa-miR-3183	CLIP-seq
MIRT947393	hsa-miR-3198	CLIP-seq
MIRT947394	hsa-miR-32	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT947396	hsa-miR-33a	CLIP-seq
MIRT947397	hsa-miR-33b	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947399	hsa-miR-363	CLIP-seq
MIRT947400	hsa-miR-367	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT947407	hsa-miR-4279	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT947409	hsa-miR-4294	CLIP-seq
MIRT947410	hsa-miR-4309	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT947414	hsa-miR-4709-3p	CLIP-seq
MIRT947415	hsa-miR-4723-3p	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT947417	hsa-miR-513a-3p	CLIP-seq
MIRT947418	hsa-miR-513c	CLIP-seq
MIRT947419	hsa-miR-514b-5p	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947422	hsa-miR-92a	CLIP-seq
MIRT947423	hsa-miR-92b	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT1548066	hsa-miR-3163	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT1548075	hsa-miR-568	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT2215663	hsa-miR-1225-3p	CLIP-seq
MIRT2215664	hsa-miR-1245b-3p	CLIP-seq
MIRT2215665	hsa-miR-133a	CLIP-seq
MIRT2215666	hsa-miR-133b	CLIP-seq
MIRT2215667	hsa-miR-141	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT2215668	hsa-miR-182	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT2215669	hsa-miR-200a	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2215670	hsa-miR-3171	CLIP-seq
MIRT2215671	hsa-miR-3189-5p	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT2215672	hsa-miR-4281	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT2215673	hsa-miR-4301	CLIP-seq
MIRT2215674	hsa-miR-431	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq
MIRT2215676	hsa-miR-4698	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT947414	hsa-miR-4709-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2215677	hsa-miR-4749-3p	CLIP-seq
MIRT2215678	hsa-miR-4774-5p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT2215679	hsa-miR-516a-5p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT2215680	hsa-miR-548ac	CLIP-seq
MIRT2215681	hsa-miR-548ag	CLIP-seq
MIRT2215682	hsa-miR-548ai	CLIP-seq
MIRT2215683	hsa-miR-548d-3p	CLIP-seq
MIRT2215684	hsa-miR-548z	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT2215685	hsa-miR-603	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT2215667	hsa-miR-141	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT2215668	hsa-miR-182	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT2215669	hsa-miR-200a	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1548066	hsa-miR-3163	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2428403	hsa-miR-3185	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215676	hsa-miR-4698	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2215678	hsa-miR-4774-5p	CLIP-seq
MIRT2428404	hsa-miR-4778-3p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT947417	hsa-miR-513a-3p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT2215680	hsa-miR-548ac	CLIP-seq
MIRT2215681	hsa-miR-548ag	CLIP-seq
MIRT2215682	hsa-miR-548ai	CLIP-seq
MIRT2215683	hsa-miR-548d-3p	CLIP-seq
MIRT2215684	hsa-miR-548z	CLIP-seq
MIRT1548075	hsa-miR-568	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT2436894	hsa-miR-1236	CLIP-seq
MIRT2215664	hsa-miR-1245b-3p	CLIP-seq
MIRT2436895	hsa-miR-1913	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2215670	hsa-miR-3171	CLIP-seq
MIRT2436896	hsa-miR-3182	CLIP-seq
MIRT2215671	hsa-miR-3189-5p	CLIP-seq
MIRT2436897	hsa-miR-324-3p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT2436898	hsa-miR-4727-5p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2436899	hsa-miR-4753-3p	CLIP-seq
MIRT2436900	hsa-miR-4758-3p	CLIP-seq
MIRT2436901	hsa-miR-4768-5p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT2215663	hsa-miR-1225-3p	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq
MIRT2215677	hsa-miR-4749-3p	CLIP-seq
MIRT2215679	hsa-miR-516a-5p	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
ATF2	Unknown	17681939
ATM	Activation	17178844
CREM	Repression	21325296
E2F1	Activation	17638884
PGR	Activation	22020934
STAT6	Unknown	18342537
TP53	Activation	12890671;15611668

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000188	Process	Inactivation of MAPK activity	IBA	21873635
GO:0000188	Process	Inactivation of MAPK activity	ISS
GO:0001706	Process	Endoderm formation	IBA	21873635
GO:0004721	Function	Phosphoprotein phosphatase activity	IBA	21873635
GO:0004722	Function	Protein serine/threonine phosphatase activity	ISS
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	1406996
GO:0005515	Function	Protein binding	IPI	10617468, 16286470, 20347885, 20936779, 25241761
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	7593328
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	7593328
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0007162	Process	Negative regulation of cell adhesion	IMP	22991462
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	17498703
GO:0008330	Function	Protein tyrosine/threonine phosphatase activity	IBA	21873635
GO:0009416	Process	Response to light stimulus	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	21873635
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS
GO:0019838	Function	Growth factor binding	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IBA	21873635
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	1406996
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035970	Process	Peptidyl-threonine dephosphorylation	IBA	21873635
GO:0035970	Process	Peptidyl-threonine dephosphorylation	ISS
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	7593328
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IBA	21873635
GO:0051019	Function	Mitogen-activated protein kinase binding	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051447	Process	Negative regulation of meiotic cell cycle	ISS
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0070262	Process	Peptidyl-serine dephosphorylation	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071850	Process	Mitotic cell cycle arrest	ISS
GO:0090027	Process	Negative regulation of monocyte chemotaxis	IMP	22991462
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	ISS
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA
GO:1903753	Process	Negative regulation of p38MAPK cascade	IBA	21873635
GO:1903753	Process	Negative regulation of p38MAPK cascade	IMP	22991462
GO:1990869	Process	Cellular response to chemokine	IMP	22991462
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
600714	3064	ENSG00000120129

Protein

UniProt ID

P28562

Protein name

Dual specificity protein phosphatase 1 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH1) (Mitogen-activated protein kinase phosphatase 1) (MAP kinase phosphatase 1) (MKP-1) (Protein-tyrosine phosphatase CL100)

Protein function

Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.

PDB

6APX , 6D65 , 6D66 , 6D67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	9 → 131	Rhodanese-like domain	Domain
PF00782	DSPc	181 → 311	Dual specificity phosphatase, catalytic domain	Domain

Sequence

MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC

Sequence length

367

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Serotonergic synapse Parkinson disease Fluid shear stress and atherosclerosis		RAF-independent MAPK1/3 activation Negative regulation of MAPK pathway

Associated diseases

Show/Hide Causal Diseases (2)

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174

Show/Hide Unknown Diseases (8)

Unknown
Disease name	Disease term	dbSNP ID	References
Endometrioma	Endometrioma		21063030
Endometriosis	Endometriosis	rs1800629, rs1143634	21063030
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	25410305, 20953200, 23668904, 15496935, 22237309, 25410305, 23668904, 15496935, 20953200
Myocardial ischemia	Myocardial Ischemia		16214533
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412