DRD5 (dopamine receptor D5)

Gene

• Entrez ID: 1816
• Gene name: Dopamine receptor D5
• Gene symbol: DRD5
• Synonyms: DBDR, DRD1B, DRD1L2
• Chromosome: 4
• Chromosome location: 4p16.1
• Summary: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017477	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IBA	21873635
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	TAS	9457173
GO:0001963	Process	Synaptic transmission, dopaminergic	NAS	11036203
GO:0001975	Process	Response to amphetamine	IEA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0001994	Process	Norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IDA	1826762
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	10531415, 11500503
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	NAS	1826762
GO:0005887	Component	Integral component of plasma membrane	TAS	9457173
GO:0005929	Component	Cilium	IDA	28154160
GO:0006874	Process	Cellular calcium ion homeostasis	TAS	9457173
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11500503
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	9457173
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	1826762, 18403039
GO:0007212	Process	Dopamine receptor signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	NAS	7727453
GO:0008306	Process	Associative learning	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0033861	Process	Negative regulation of NAD(P)H oxidase activity	IDA	16352863
GO:0035240	Function	Dopamine binding	IDA	1826762
GO:0042060	Process	Wound healing	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0045202	Component	Synapse	IEA
GO:0045762	Process	Positive regulation of adenylate cyclase activity	NAS	7727453
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045924	Process	Regulation of female receptivity	IEA
GO:0046960	Process	Sensitization	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	TAS	9457173
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	16352863
GO:0097730	Component	Non-motile cilium	IDA	20531939

Other IDs

• MIM: 126453
• HGNC: 3026
• e!Ensembl: ENSG00000169676

Protein

• UniProt ID: P21918
• Protein name: D(1B) dopamine receptor (D(5) dopamine receptor) (D1beta dopamine receptor) (Dopamine D5 receptor)
• Protein function: Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 359	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
  VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
  IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
  HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
  MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
  IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
  FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
  GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH

• Sequence length: 477

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Dopaminergic synapse

Reactome:

Dopamine receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Disease name	Disease term	References
	Attention Deficit Disorder	14699430, 14732906
	Attention deficit hyperactivity disorder	14732906, 14699430
	Benign essential blepharospasm
	Bipolar Disorder	11304828, 14708030, 10578238, 20874815, 24700553, 9774780
	Depression, Bipolar	14708030
	Blepharospasm	11781417
	Manic	14708030
	Manic Disorder	14708030
	Melancholia	14708030
	Endogenous depression	14708030
	Depressive disorder	14708030
	Unipolar Depression	14708030
	Depressive Syndrome	14708030
	Depression, Neurotic	14708030
	Minimal Brain Dysfunction	14699430, 14732906
	Psychosis, Brief Reactive	14708030
	Psychotic Disorders	14708030
	Schizoaffective Disorder	14708030
	Schizophreniform Disorders	14708030