GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

DRD2 (dopamine receptor D2)

Gene

1813

Dopamine receptor D2

DRD2

D2DR, D2R

11q23.2

This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1076560	C>A,G	Likely-benign, drug-response	Intron variant
rs1800496	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

Show/Hide all(73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437986	hsa-miR-9-5p	Luciferase reporter assay	24675081
MIRT437986	hsa-miR-9-5p	Luciferase reporter assay	24675081
MIRT945332	hsa-miR-1285	CLIP-seq
MIRT945333	hsa-miR-1291	CLIP-seq
MIRT945334	hsa-miR-1827	CLIP-seq
MIRT945335	hsa-miR-2467-3p	CLIP-seq
MIRT945336	hsa-miR-2682	CLIP-seq
MIRT945337	hsa-miR-296-5p	CLIP-seq
MIRT945338	hsa-miR-3187-5p	CLIP-seq
MIRT945339	hsa-miR-3190	CLIP-seq
MIRT945340	hsa-miR-3202	CLIP-seq
MIRT945341	hsa-miR-326	CLIP-seq
MIRT945342	hsa-miR-330-5p	CLIP-seq
MIRT945343	hsa-miR-345	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945346	hsa-miR-378g	CLIP-seq
MIRT945347	hsa-miR-4261	CLIP-seq
MIRT945348	hsa-miR-4486	CLIP-seq
MIRT945349	hsa-miR-4490	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT945352	hsa-miR-449c	CLIP-seq
MIRT945353	hsa-miR-4533	CLIP-seq
MIRT945354	hsa-miR-4666-5p	CLIP-seq
MIRT945355	hsa-miR-4699-3p	CLIP-seq
MIRT945356	hsa-miR-4732-3p	CLIP-seq
MIRT945357	hsa-miR-4747-5p	CLIP-seq
MIRT945358	hsa-miR-4774-5p	CLIP-seq
MIRT945359	hsa-miR-4802-3p	CLIP-seq
MIRT945360	hsa-miR-512-5p	CLIP-seq
MIRT945361	hsa-miR-612	CLIP-seq
MIRT945362	hsa-miR-622	CLIP-seq
MIRT945336	hsa-miR-2682	CLIP-seq
MIRT945339	hsa-miR-3190	CLIP-seq
MIRT945363	hsa-miR-3199	CLIP-seq
MIRT945340	hsa-miR-3202	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945347	hsa-miR-4261	CLIP-seq
MIRT945364	hsa-miR-4278	CLIP-seq
MIRT945365	hsa-miR-4480	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT945352	hsa-miR-449c	CLIP-seq
MIRT945366	hsa-miR-4515	CLIP-seq
MIRT945353	hsa-miR-4533	CLIP-seq
MIRT945367	hsa-miR-4652-5p	CLIP-seq
MIRT945368	hsa-miR-4716-3p	CLIP-seq
MIRT945357	hsa-miR-4747-5p	CLIP-seq
MIRT945369	hsa-miR-9	CLIP-seq
MIRT2215049	hsa-miR-1252	CLIP-seq
MIRT2215050	hsa-miR-185	CLIP-seq
MIRT2215051	hsa-miR-3125	CLIP-seq
MIRT2215052	hsa-miR-3916	CLIP-seq
MIRT2215053	hsa-miR-4306	CLIP-seq
MIRT2215054	hsa-miR-4644	CLIP-seq
MIRT2215055	hsa-miR-4753-5p	CLIP-seq
MIRT2215056	hsa-miR-4768-3p	CLIP-seq
MIRT2519492	hsa-miR-3150b-3p	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT2519493	hsa-miR-4689	CLIP-seq
MIRT2519494	hsa-miR-4784	CLIP-seq
MIRT2519492	hsa-miR-3150b-3p	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT2519493	hsa-miR-4689	CLIP-seq
MIRT2519494	hsa-miR-4784	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17317773;18354387
RELA	Unknown	17317773;18354387

Show/Hide all(132)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IBA	21873635
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IDA	8301582
GO:0001659	Process	Temperature homeostasis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001975	Process	Response to amphetamine	ISS
GO:0001976	Process	Nervous system process involved in regulation of systemic arterial blood pressure	ISS
GO:0002027	Process	Regulation of heart rate	ISS
GO:0002028	Process	Regulation of sodium ion transport	ISS
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10692483, 17380124, 19632986, 23296780, 23624386, 23637801, 28734930, 29568380
GO:0005886	Component	Plasma membrane	IDA	26554819
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	8413587
GO:0005929	Component	Cilium	IDA	28154160
GO:0006914	Process	Autophagy	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007194	Process	Negative regulation of adenylate cyclase activity	IBA	21873635
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IBA	21873635
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IDA	8666994, 26554819
GO:0007270	Process	Neuron-neuron synaptic transmission	ISS
GO:0007409	Process	Axonogenesis	ISS
GO:0007416	Process	Synapse assembly	ISS
GO:0007608	Process	Sensory perception of smell	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0007628	Process	Adult walking behavior	ISS
GO:0008104	Process	Protein localization	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008306	Process	Associative learning	ISS
GO:0008542	Process	Visual learning	ISS
GO:0009416	Process	Response to light stimulus	ISS
GO:0009636	Process	Response to toxic substance	IEA
GO:0010039	Process	Response to iron ion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IBA	21873635
GO:0014069	Component	Postsynaptic density	IEA
GO:0014854	Process	Response to inactivity	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0021756	Process	Striatum development	IEA
GO:0021769	Process	Orbitofrontal cortex development	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	ISS
GO:0021984	Process	Adenohypophysis development	ISS
GO:0030139	Component	Endocytic vesicle	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	ISS
GO:0030432	Process	Peristalsis	ISS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031223	Process	Auditory behavior	IEA
GO:0032147	Process	Activation of protein kinase activity	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033602	Process	Negative regulation of dopamine secretion	IEA
GO:0034776	Process	Response to histamine	IDA	16839358
GO:0035094	Process	Response to nicotine	IEA
GO:0035240	Function	Dopamine binding	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042220	Process	Response to cocaine	ISS
GO:0042321	Process	Negative regulation of circadian sleep/wake cycle, sleep	IEA
GO:0042417	Process	Dopamine metabolic process	IC	8301582
GO:0042493	Process	Response to drug	ISS
GO:0042756	Process	Drinking behavior	IEA
GO:0042802	Function	Identical protein binding	IPI	18668123, 23624386, 23637801, 28734930
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043266	Process	Regulation of potassium ion transport	IBA	21873635
GO:0043266	Process	Regulation of potassium ion transport	ISS
GO:0043278	Process	Response to morphine	ISS
GO:0043473	Process	Pigmentation	IEA
GO:0043666	Process	Regulation of phosphoprotein phosphatase activity	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046717	Process	Acid secretion	IEA
GO:0048148	Process	Behavioral response to cocaine	ISS
GO:0048149	Process	Behavioral response to ethanol	ISS
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	ISS
GO:0048678	Process	Response to axon injury	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	ISS
GO:0050482	Process	Arachidonic acid secretion	IDA	8301582
GO:0050709	Process	Negative regulation of protein secretion	IDA	16839358
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0051482	Process	Positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	21873635
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IC	8301582
GO:0051586	Process	Positive regulation of dopamine uptake involved in synaptic transmission	ISS
GO:0051823	Process	Regulation of synapse structural plasticity	IEA
GO:0051898	Process	Negative regulation of protein kinase B signaling	ISS
GO:0051898	Process	Negative regulation of protein kinase B signaling	NAS	21711983
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	ISS
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060124	Process	Positive regulation of growth hormone secretion	ISS
GO:0060134	Process	Prepulse inhibition	ISS
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IBA	21873635
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IGI	17194762
GO:0060160	Process	Negative regulation of dopamine receptor signaling pathway	ISS
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0060548	Process	Negative regulation of cell death	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0090325	Process	Regulation of locomotion involved in locomotory behavior	IEA
GO:0097730	Component	Non-motile cilium	IDA	20531939
GO:0098691	Component	Dopaminergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IBA	21873635
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IBA	21873635
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:1900168	Process	Positive regulation of glial cell-derived neurotrophic factor production	IDA	23373701
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:1901386	Process	Negative regulation of voltage-gated calcium channel activity	IBA	21873635
GO:1990384	Process	Hyaloid vascular plexus regression	ISS
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

MIM	HGNC	e!Ensembl
126450	3023	ENSG00000149295

Protein

UniProt ID

P14416

Protein name

D(2) dopamine receptor (Dopamine D2 receptor)

Protein function

Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase (PubMed:21645528). Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5 (By simi

PDB

5AER , 6CM4 , 6LUQ , 6VMS , 7DFP , 7JVR , 8IRS , 8TZQ , 8U02

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	51 → 426	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC

Sequence length

443

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Gap junction Dopaminergic synapse Parkinson disease Cocaine addiction Alcoholism		Dopamine receptors

Associated diseases

Show/Hide Causal Diseases (8)

Causal
Disease name	Disease term	dbSNP ID	References
Attention deficit hyperactivity disorder	Attention Deficit Disorder, Attention deficit hyperactivity disorder	rs120074176, rs786205019	17671965
Hyperprolactinemia	Hyperprolactinemia	rs398122522, rs376188691, rs754974807	19339912, 15286066
Hypertension	Hypertensive disease	rs13306026, rs13333226	11566895
Myoclonic dystonia	Myoclonic dystonia	rs121908489, rs121908490, rs863223283, rs121908491, rs863223284, rs1584531843, rs121908492, rs863223285, rs398123812, rs786205860, rs794727794, rs886039595, rs1057517990, rs1057519246, rs1189469219, rs1064794321, rs1064797339, rs1554352819, rs1554355416, rs1554353106, rs1554345052, rs1554352952, rs1554358727, rs1554352906, rs1554345077, rs1554345162, rs1554345170, rs1562806242, rs1562805960, rs1562812370, rs1562853011, rs1562811414, rs1584637958, rs1584663425, rs1584663290, rs1584546131, rs372686312, rs1584546494, rs1584692239, rs1584700882, rs1584546238, rs1799563986
Parkinson disease	Parkinsonian Disorders, Autosomal Dominant Juvenile Parkinson Disease, PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE, Parkinson Disease	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	15469457, 12476322, 9171869, 12476322, 15469457, 9171869, 8558425
Pituitary adenoma	Pituitary Adenoma	rs5030861, rs104894194, rs121908356, rs121908347, rs727502931, rs121908348, rs121908349, rs111033271, rs121908351, rs121917839, rs121917840, rs587776681, rs193922688, rs121917841, rs587776682, rs587776683, rs121917842, rs121917843, rs121917844, rs121917845, rs11554273, rs121913495, rs121913494, rs137854533, rs140016178, rs397517323, rs397517327, rs397517329, rs397517341, rs397517342, rs183431253, rs397517350, rs370983472, rs397517367, rs794726693, rs727502919, rs766673446, rs786204663, rs1556379508, rs876657754, rs773464867, rs878853337, rs886037871, rs762529663, rs1057517027, rs1057517041, rs1057516832, rs1057517424, rs1057516846, rs1057524265, rs1060499789, rs750803248, rs1064797071, rs756147087, rs758382198, rs750880909, rs1554877806, rs769433759, rs1474524543, rs866435331, rs936479651, rs146918863, rs1554182514, rs1436089021, rs1554182507, rs1554182481, rs1554182645, rs1554182405, rs1554182632, rs747955135, rs745571683, rs1190307769, rs1564808024, rs1214465435, rs1589424694, rs1200012430, rs1377982927, rs1230303971, rs750027965, rs1292050472, rs1278603247, rs1862873659, rs1338446830, rs771766431, rs759981467, rs780917129, rs1221464948, rs1166948274, rs754876029, rs762805265	12727942
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	11245917, 21187413, 18583979, 10831489
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	1829682, 7936204, 11860278, 1829682, 11860278, 7936204, 7936204, 1829682, 11860278, 7936204, 11860278, 1829682, 11860278, 1829682, 7936204

Show/Hide Unknown Diseases (39)

Unknown
Disease name	Disease term	dbSNP ID	References
Anhedonia	Anhedonia		20620876
Anxiety disorder	Anxiety, Anxiety Disorders, Anxiety States, Neurotic		20532872, 18305461, 18305461, 20532872
Ballismus	Ballismus		16435402
Basal ganglia diseases	Basal Ganglia Diseases		18480698, 11198054, 12211096, 19506579, 19225277
Bipolar disorder	Bipolar Disorder		20874815, 22514151, 23044341, 24229495, 22326841
Catalepsy	Catalepsy		3283778, 9618422, 1365866, 7845605
Clonic seizures	Clonic Seizures		1829682, 11860278, 7936204
Cognitive disorder	Cognition Disorders		19910723
Delirium	Delirium		19309018, 19739106
Development disorder	Developmental Disabilities, Child Development Deviations, Child Development Disorders, Specific		21592505
Dyskinesia	Dyskinesia, Drug-Induced		10534246, 14629710, 7845605
Dyskinetic syndrome	Dyskinetic syndrome		16435402
Extrapyramidal disease	Extrapyramidal Disorders		12211096, 11198054, 19506579, 19225277, 18480698
Hemiballismus	Hemiballismus		16435402
Hypotonic seizures	Epileptic drop attack		1829682, 7936204, 11860278
Impulse control disorder	Disruptive, Impulse Control, and Conduct Disorders		17332411, 19940168, 20671181
Intermittent explosive disorder	Intermittent Explosive Disorder		20671181, 17332411, 19940168
Jacksonian seizure	Jacksonian Seizure		11860278, 7936204, 1829682
Language disorders	Language Disorders, Acquired Language Disorders		23691092
Lenticulostriate disorders	Lenticulostriate Disorders		19506579, 11198054, 19225277, 12211096, 18480698
Orofacial dyskinesia	Lingual-Facial-Buccal Dyskinesia		16435402
Memory disorders	Memory Disorders		21592505
Age-related memory disorders	Age-Related Memory Disorders		21592505
Mental depression	Mental Depression, Depressive disorder, Major depression, single episode, Unipolar Depression, Recurrent depression, Major Depressive Disorder	rs587778876, rs587778877	23683269, 21540761, 24780147, 23512949, 20526230, 24780147, 23512949, 23683269, 21540761, 20526230, 11728608, 23696934, 24555772, 23683269, 24322206, 22796099, 1385598, 22796099, 23683269, 29942085, 24555772, 23696934, 24322206
Minimal brain dysfunction	Minimal Brain Dysfunction		17671965
Mood disorder	Mood Disorders		15108180, 24322206, 11992560, 29942085, 24655768, 21130502
Movement disorders	Movement Disorders		6858777
Myoclonus-dystonia syndrome	Myoclonus-dystonia syndrome
Obsessive-compulsive disorder	Obsessive compulsive behavior
Oral dyskinesia	Oral Dyskinesia		16435402
Panic disorder	Panic Attacks
Parkinsonian disease	Autosomal Dominant Parkinsonism, Autosomal Recessive Parkinsonism, Familial Juvenile Parkinsonism, Parkinsonism, Juvenile		12476322, 9171869, 15469457, 9171869, 15469457, 12476322, 9171869, 12476322, 15469457, 15469457, 12476322, 9171869
Personality disorders	Personality Disorders
Pituitary neoplasms	Pituitary Neoplasms		12727942
Pituitary carcinoma	Pituitary carcinoma		12727942
Ramsay hunt paralysis syndrome	Ramsay Hunt Paralysis Syndrome		12476322, 15469457, 9171869
Spinal cord myoclonus	Spinal cord myoclonus
Status marmoratus	Etat Marbre		6858777
Writer`s cramp	Writer`s Cramp

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412