DMP1 (dentin matrix acidic phosphoprotein 1)

Gene

• Entrez ID: 1758
• Gene name: Dentin matrix acidic phosphoprotein 1
• Gene symbol: DMP1
• Synonyms: ARHP, ARHR, DMP-1
• Chromosome: 4
• Chromosome location: 4q22.1
• Summary: Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cell

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893834	A>G,T	Pathogenic	Missense variant, initiator codon variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736513	hsa-miR-708-5p	Western blotting, Microarray, qRT-PCR, Flow cytometry	32952566
MIRT736515	hsa-miR-642a-5p	Western blotting, Microarray, qRT-PCR, Flow cytometry	32952566
MIRT939145	hsa-miR-1200	CLIP-seq
MIRT939146	hsa-miR-1236	CLIP-seq
MIRT939147	hsa-miR-150	CLIP-seq
MIRT939148	hsa-miR-3156-3p	CLIP-seq
MIRT939149	hsa-miR-4299	CLIP-seq
MIRT939150	hsa-miR-4301	CLIP-seq
MIRT939151	hsa-miR-4456	CLIP-seq
MIRT939152	hsa-miR-4687-3p	CLIP-seq
MIRT939153	hsa-miR-4713-5p	CLIP-seq
MIRT939154	hsa-miR-483-3p	CLIP-seq
MIRT939155	hsa-miR-532-3p	CLIP-seq
MIRT939156	hsa-miR-548q	CLIP-seq
MIRT939157	hsa-miR-597	CLIP-seq
MIRT939158	hsa-miR-647	CLIP-seq
MIRT939159	hsa-miR-668	CLIP-seq
MIRT2213170	hsa-miR-4290	CLIP-seq
MIRT2213171	hsa-miR-4469	CLIP-seq
MIRT2213172	hsa-miR-4655-3p	CLIP-seq
MIRT2213173	hsa-miR-4687-5p	CLIP-seq
MIRT2213174	hsa-miR-4786-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0005178	Function	Integrin binding	TAS	8509401
GO:0005509	Function	Calcium ion binding	TAS	8509401
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031214	Process	Biomineral tissue development	IEA
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0070173	Process	Regulation of enamel mineralization	IEA

Other IDs

• MIM: 600980
• HGNC: 2932
• e!Ensembl: ENSG00000152592

Protein

• UniProt ID: Q13316
• Protein name: Dentin matrix acidic phosphoprotein 1 (DMP-1) (Dentin matrix protein 1)
• Protein function: May have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts, unphosphorylated form acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteob
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07263	DMP1	1 → 513	Dentin matrix protein 1 (DMP1)	Family

• Sequence:

  MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEE
  QANEDPSDSTQSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSG
  PGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEG
  GDSTQESESEEHWVGGGSDGESSHGDGSELDDEGMQSDDPESIRSERGNSRMNSAGMKSK
  ESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSN
  SRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVV
  SESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE
  SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQ
  LKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGY

• Sequence length: 513

Pathways

KEGG:

ECM-receptor interaction

Reactome:

ECM proteoglycans
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Acromesomelic dysplasia	Acromesomelic dysplasia Hunter-Thompson type	rs863223287, rs28936683, rs121909350, rs121909351, rs28931582, rs28929479, rs121912739, rs879255257, rs863225041, rs863225042, rs745854387, rs1057519324, rs1057519335, rs1057519334, rs1057519333, rs1057519336, rs1177728492, rs753644648, rs771373457, rs749952755, rs1828106198, rs1311857509, rs1828226013, rs1827867580, rs1828356952, rs1828565145, rs1828107536
Brachydactyly	BRACHYDACTYLY, TYPE A2, Brachydactyly type C, BRACHYDACTYLY, TYPE A1, C	rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852, rs121917853, rs121917854, rs121917855, rs121917859, rs121917861, rs267606873, rs267606872, rs267606985, rs267606986, rs267606987, rs267606988, rs28933082, rs397514519, rs869025613, rs869025614, rs886039878, rs1553540620, rs1057518333, rs1948841937, rs1948868228, rs1948842030, rs1948842142
Chondrodysplasia punctata	Chondrodysplasia, Grebe type	rs80338714, rs398122843, rs121434599, rs121434604, rs2107055197, rs2089231699
Craniosynostosis	Craniosynostosis	rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs281865153, rs281865154, rs864321680, rs864321681, rs1057517670, rs1085307122, rs1064794325, rs1884302, rs1555750816, rs1599823350
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359, rs180177151, rs180177154, rs180177153, rs35689081, rs35887622, rs80338944, rs104894396, rs104894398, rs80338947, rs80338948, rs80338942, rs104894402, rs104894403, rs80338945, rs28931594, rs80338940, rs80338941, rs80356590, rs80338950, rs387906706, rs387906707, rs387906708, rs398122848, rs387907016, rs587776894, rs387907088, rs397515411, rs370965183, rs398122930, rs199897298, rs111033187, rs111033448, rs199606180, rs111033284, rs397516413, rs111033305, rs111033220, rs111033256, rs111033297, rs111033253, rs104894408, rs111033295, rs397516874, rs76434661, rs111033335, rs397517323, rs111033247, rs367928692, rs374793617, rs143939430, rs397515605, rs80338939, rs200656442, rs779748859, rs587781261, rs587781262, rs143343083, rs200147906, rs730880338, rs797044491, rs146281367, rs756484720, rs869025593, rs201306709, rs540895576, rs777777359, rs879255246, rs1554358720, rs142498437, rs377145777, rs1057517519, rs779077039, rs952741388, rs1060499797, rs764139009, rs1060499590, rs1064794012, rs1064797115, rs756790858, rs775633137, rs1554952443, rs1554952193, rs782063761, rs1199012623, rs756147087, rs1555648043, rs1555661490, rs1553196233, rs781546107, rs111033190, rs775428246, rs782539587, rs537227442, rs148695069, rs1554835827, rs953422571, rs1554834186, rs1554834161, rs1554835103, rs1554577339, rs1554577402, rs768471577, rs782279338, rs781951909, rs998045226, rs375759781, rs755804651, rs1557458426, rs767797828, rs538027448, rs1559366084, rs367688416, rs1558480402, rs1558490542, rs1559870857, rs1560690591, rs1561299289, rs1562817224, rs1562817529, rs1562822565, rs1562835391, rs1564113368, rs1564554255, rs773851192, rs1564555240, rs761261855, rs1564805114, rs1565522273, rs1565127413, rs781790246, rs1565430886, rs1565469959, rs746667217, rs1565819402, rs1565855932, rs150529554, rs1567939793, rs201866631, rs754472294, rs1559372512, rs1558464965, rs1558488902, rs775062249, rs1226171550, rs1561590396, rs765574676, rs762876554, rs757327146, rs1564949059, rs1565519673, rs368050948, rs1565541888, rs781989117, rs1565402473, rs750358148, rs1386887007, rs1209665716, rs1567641234, rs1237955948, rs1569042782, rs752672077, rs146689036, rs1560070780, rs149712664, rs1564556995, rs762226905, rs773573968, rs1568528171, rs1198256157, rs377267777, rs370564476, rs1577876794, rs747787770, rs759432278, rs1043716893, rs1581138934, rs2033773650, rs1421964916, rs771766431, rs780917129, rs1895773215, rs1895769400, rs761543680, rs1565920060
Hypophosphatemic rickets	Hypophosphatemic Rickets, Hypophosphatemic Rickets, Autosomal Recessive, 1, Autosomal recessive hypophosphatemic rickets	rs104894347, rs28937882, rs587776696, rs587776697, rs587776698, rs121908248, rs587776797, rs121908249, rs193922701, rs193922702, rs886041227, rs886041363, rs886041296, rs886041369, rs866429868, rs1556025994, rs1064793847, rs1556128253, rs1554278331, rs899142959, rs373044722	17033621
Hypophosphatemic vitamin d refractory rickets, x-linked	Autosomal recessive hypophosphatemic vitamin D refractory rickets	rs2146979490, rs137853268, rs137853269, rs137853270, rs137853271, rs151340626, rs193922454, rs193922455, rs193922456, rs193922457, rs193922458, rs193922459, rs193922460, rs797044808, rs875989883, rs886039583, rs886041361, rs886041364, rs886041368, rs886041372, rs886041227, rs886041223, rs886041695, rs886041363, rs886041225, rs886041631, rs886041446, rs886041362, rs886041839, rs886041367, rs886041374, rs886041529, rs886041359, rs886041224, rs886041369, rs886041226, rs1057517799, rs1057517798, rs866429868, rs770573978, rs1057521800, rs1064793956, rs1064793228, rs1064795106, rs1064796845, rs1131691731, rs1131691841, rs1131691645, rs151306376, rs1556010757, rs1556012055, rs202074612, rs770630990, rs1556012100, rs1556012094, rs1556014263, rs1556014287, rs1556020460, rs1556020474, rs1556020485, rs1556020752, rs1556020798, rs1556020818, rs771208171, rs1556023495, rs1556023503, rs1556023505, rs1556023528, rs1556024541, rs1556025314, rs1556025936, rs1556025968, rs1556026027, rs1556026042, rs1556029499, rs1556029516, rs1556029519, rs1556030465, rs1556030487, rs1556030502, rs1556036014, rs754449807, rs375593493, rs1269067103, rs1556070724, rs1556070890, rs1556071086, rs1556071123, rs1556071138, rs1064796928, rs1556091855, rs1556128043, rs1556128253, rs1556135308, rs1556135467, rs1556135477, rs772130004, rs886041296, rs1556138407, rs1556138590, rs1556138742, rs1556148392, rs1556148532, rs748792378, rs1240767654, rs1556151004, rs1556151071, rs1556151137, rs1556151545, rs1556200989, rs1556201034, rs1556201217, rs1556205815, rs1057517981, rs1556206093, rs1556206335, rs1556206403, rs1556138769, rs1556026033, rs1556020770, rs1400504292, rs1569442206, rs1602240890, rs1602240926, rs1602241023, rs1602244836, rs1602273900, rs1602274883, rs1602274893, rs1602274929, rs1602274950, rs1602288211, rs1602290398, rs1602292528, rs1556025994, rs1602303865, rs1602304005, rs1602307078, rs1602307094, rs1602307107, rs1602324484, rs1602324630, rs1602354302, rs1602363343, rs1602363550, rs1602395717, rs1602402229, rs1602402258, rs1602405079, rs1602405176, rs1602405239, rs1602405375, rs1602411514, rs1602439597, rs1602439611, rs1602439662, rs1602442819, rs1602442871, rs1602273769, rs1602244774, rs1602244810, rs915608304
Multiple synostoses syndrome	MULTIPLE SYNOSTOSES SYNDROME 2	rs74315386, rs74315388, rs121909347, rs121918322, rs1555223925, rs1554571213
Osteochondrodysplasia	Osteochondrodysplasias	rs386833498, rs104893919, rs104893916, rs386833492, rs121908078, rs386833497, rs386833507, rs200963884, rs121908077, rs786204675, rs763198695, rs1554095433, rs766836061
Skeletal dysplasia	Skeletal dysplasia	rs121912632, rs121912633, rs121912634, rs121912636, rs121912637, rs267607147, rs387906324, rs267607150, rs397514473, rs398123438, rs515726153, rs515726154, rs515726162, rs515726163, rs515726172, rs757011098
Symphalangism	SYMPHALANGISM, PROXIMAL, 1B	rs28936683, rs74315388, rs74315389, rs121909349

Unknown
Disease name	Disease term	dbSNP ID	References
Dwarfism	Dwarfism
Enthesitis	Enthesitis
Fibular hypoplasia and complex brachydactyly	Fibular hypoplasia and complex brachydactyly
Malabsorption syndrome	Malabsorption Syndrome
Osteoarthritis of hip	Osteoarthritis of hip
Osteosclerosis	Osteosclerosis
Phosphate diabetes	Phosphate Diabetes
Polyarthritis	Polyarthritis
Renal hypophosphatemia	Renal hypophosphatemia
Rickets	Rickets, Adult Rickets