ZFPM1 (zinc finger protein, FOG family member 1)

Gene

• Entrez ID: 161882
• Gene name: Zinc finger protein, FOG family member 1
• Gene symbol: ZFPM1
• Synonyms: FOG, FOG1, ZC2HC11A, ZNF408, ZNF89A
• Chromosome: 16
• Chromosome location: 16q24.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437880	hsa-miR-183-5p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437880	hsa-miR-183-5p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437881	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437881	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT694631	hsa-miR-3130-5p	HITS-CLIP	23313552
MIRT694630	hsa-miR-4482-5p	HITS-CLIP	23313552
MIRT694629	hsa-miR-29a-3p	HITS-CLIP	23313552
MIRT694628	hsa-miR-29b-3p	HITS-CLIP	23313552
MIRT694627	hsa-miR-29c-3p	HITS-CLIP	23313552
MIRT694626	hsa-miR-6871-3p	HITS-CLIP	23313552
MIRT694625	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT694624	hsa-miR-423-3p	HITS-CLIP	23313552
MIRT694623	hsa-miR-601	HITS-CLIP	23313552
MIRT694622	hsa-miR-4764-3p	HITS-CLIP	23313552
MIRT694621	hsa-miR-585-5p	HITS-CLIP	23313552
MIRT694620	hsa-miR-5682	HITS-CLIP	23313552
MIRT439236	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT439236	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT694631	hsa-miR-3130-5p	HITS-CLIP	23313552
MIRT694630	hsa-miR-4482-5p	HITS-CLIP	23313552
MIRT694629	hsa-miR-29a-3p	HITS-CLIP	23313552
MIRT694628	hsa-miR-29b-3p	HITS-CLIP	23313552
MIRT694627	hsa-miR-29c-3p	HITS-CLIP	23313552
MIRT694626	hsa-miR-6871-3p	HITS-CLIP	23313552
MIRT694625	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT694624	hsa-miR-423-3p	HITS-CLIP	23313552
MIRT694623	hsa-miR-601	HITS-CLIP	23313552
MIRT694622	hsa-miR-4764-3p	HITS-CLIP	23313552
MIRT694621	hsa-miR-585-5p	HITS-CLIP	23313552
MIRT694620	hsa-miR-5682	HITS-CLIP	23313552
MIRT2154136	hsa-miR-1470	CLIP-seq
MIRT2154137	hsa-miR-1913	CLIP-seq
MIRT2154138	hsa-miR-324-3p	CLIP-seq
MIRT2154139	hsa-miR-3937	CLIP-seq
MIRT2154140	hsa-miR-4313	CLIP-seq
MIRT2154141	hsa-miR-4645-5p	CLIP-seq
MIRT2154142	hsa-miR-4673	CLIP-seq
MIRT2154143	hsa-miR-4767	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	15920471
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001085	Function	RNA polymerase II transcription factor binding	IBA	21873635
GO:0001085	Function	RNA polymerase II transcription factor binding	IPI	11675338, 15920471
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IEA
GO:0002295	Process	T-helper cell lineage commitment	IC	21646796
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003181	Process	Atrioventricular valve morphogenesis	ISS
GO:0003192	Process	Mitral valve formation	ISS
GO:0003195	Process	Tricuspid valve formation	ISS
GO:0003714	Function	Transcription corepressor activity	IGI	15920471
GO:0005515	Function	Protein binding	IPI	19513100, 21047798, 21988832
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	15920471
GO:0007507	Process	Heart development	IBA	21873635
GO:0007596	Process	Blood coagulation	TAS
GO:0008134	Function	Transcription factor binding	IPI	12483298
GO:0010724	Process	Regulation of definitive erythrocyte differentiation	IDA	15920471
GO:0010724	Process	Regulation of definitive erythrocyte differentiation	IMP	17207461
GO:0017053	Component	Transcription repressor complex	IDA	15920471
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030219	Process	Megakaryocyte differentiation	IBA	21873635
GO:0030219	Process	Megakaryocyte differentiation	ISS
GO:0030220	Process	Platelet formation	IGI	11675338
GO:0030851	Process	Granulocyte differentiation	IEA
GO:0032091	Process	Negative regulation of protein binding	ISS
GO:0032642	Process	Regulation of chemokine production	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IDA	21646796
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	21646796
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0035855	Process	Megakaryocyte development	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0055008	Process	Cardiac muscle tissue morphogenesis	ISS
GO:0060318	Process	Definitive erythrocyte differentiation	IEA
GO:0060319	Process	Primitive erythrocyte differentiation	IEA
GO:0060377	Process	Negative regulation of mast cell differentiation	ISS
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060413	Process	Atrial septum morphogenesis	ISS
GO:0071733	Process	Transcriptional activation by promoter-enhancer looping	ISS

Other IDs

• MIM: 601950
• HGNC: 19762
• e!Ensembl: ENSG00000179588

Protein

• UniProt ID: Q8IX07
• Protein name: Zinc finger protein ZFPM1 (Friend of GATA protein 1) (FOG-1) (Friend of GATA 1) (Zinc finger protein 89A) (Zinc finger protein multitype 1)
• Protein function: Transcription regulator that plays an essential role in erythroid and megakaryocytic cell differentiation. Essential cofactor that acts via the formation of a heterodimer with transcription factors of the GATA family GATA1, GATA2 and GATA3. Such
• PDB: 2XU7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	291 → 314	Zinc finger, C2H2 type	Domain
  PF12874	zf-met	974 → 994		Domain

• Sequence:

  MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPT
  SPGGPKELEGQEPEPRPTEEEPGSPWSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHG
  SVQTRASSPRQAEPSPALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPV
  PAGGLLSVLLTAEPHSTPGHPVKKEPAEPTCPAPAHDLQLLPQQAGMASILATAVINKDV
  FPCKDCGIWYRSERNLQAHLLYYCASRQGTGSPAAAATDEKPKETYPNERVCPFPQCRKS
  CPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHSCGFISTTR
  DILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGL
  APTPSPGLDRKALAEATNGEARAEPLAQNGGSSEPPAAPRSIKVEAVEEPEAAPILGPGE
  PGPQAPSRTPSPRSPAPARVKAELSSPTPGSSPVPGELGLAGALFLPQYVFGPDAAPPAS
  EILAKMSELVHSRLQQGAGAGAGGAQTGLFPGAPKGATCFECEITFSNVNNYYVHKRLYC
  SGRRAPEDAPAARRPKAPPGPARAPPGQPAEPDAPRSSPGPGAREEGAGGAATPEDGAGG
  RGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPAAP
  PGPPGPAAPPAPSPAAPVRTRRRRKLYELHAAGAPPPPPPGHAPAPESPRPGSGSGSGPG
  LAPARSPGPAADGPIDLSKKPRRPLPGAPAPALADYHECTACRVSFHSLEAYLAHKKYSC
  PAAPPPGALGLPAAACPYCPPNGPVRGDLLEHFRLAHGLLLGAPLAGPGVEARTPADRGP
  SPAPAPAASPQPGSRGPRDGLGPEPQEPPPGPPPSPAAAPEAVPPPPAPPSYSDKGVQTP
  SKGTPAPLPNGNHRYCRLCNIKFSSLSTFIAHKKYYCSSHAAEHVK

• Sequence length: 1006

Pathways

Reactome:

RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Factors involved in megakaryocyte development and platelet production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	26025128

Unknown
Disease name	Disease term	dbSNP ID	References
Testicular germ cell tumor	Testicular Germ Cell Tumor		26503584, 28604728, 28604732