AP2A2 (adaptor related protein complex 2 subunit alpha 2)

Gene

• Entrez ID: 161
• Gene name: Adaptor related protein complex 2 subunit alpha 2
• Gene symbol: AP2A2
• Synonyms: ADTAB, CLAPA2, HIP-9, HIP9, HYPJ
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: The protein encoded by this gene is a subunit of the AP-2 adaptor protein complex, which is involved in linking lipid and protein membrane components with the clathrin lattice. This interaction supports the formation of clathrin-coated vesicles, and the e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025343	hsa-miR-34a-5p	Proteomics	21566225
MIRT025343	hsa-miR-34a-5p	Proteomics	21566225
MIRT025343	hsa-miR-34a-5p	Proteomics	21566225
MIRT025343	hsa-miR-34a-5p	Proteomics	21566225
MIRT048756	hsa-miR-93-5p	CLASH	23622248
MIRT043335	hsa-miR-331-3p	CLASH	23622248
MIRT040723	hsa-miR-92b-3p	CLASH	23622248
MIRT037420	hsa-miR-744-5p	CLASH	23622248
MIRT036876	hsa-miR-877-3p	CLASH	23622248
MIRT441215	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441215	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT787565	hsa-miR-10a	CLIP-seq
MIRT787566	hsa-miR-10b	CLIP-seq
MIRT787567	hsa-miR-1200	CLIP-seq
MIRT787568	hsa-miR-1228	CLIP-seq
MIRT787569	hsa-miR-1238	CLIP-seq
MIRT787570	hsa-miR-1289	CLIP-seq
MIRT787571	hsa-miR-1291	CLIP-seq
MIRT787572	hsa-miR-1343	CLIP-seq
MIRT787573	hsa-miR-3173-5p	CLIP-seq
MIRT787574	hsa-miR-3198	CLIP-seq
MIRT787575	hsa-miR-3921	CLIP-seq
MIRT787576	hsa-miR-4254	CLIP-seq
MIRT787577	hsa-miR-4294	CLIP-seq
MIRT787578	hsa-miR-4308	CLIP-seq
MIRT787579	hsa-miR-4309	CLIP-seq
MIRT787580	hsa-miR-431	CLIP-seq
MIRT787581	hsa-miR-4324	CLIP-seq
MIRT787582	hsa-miR-4488	CLIP-seq
MIRT787583	hsa-miR-4653-5p	CLIP-seq
MIRT787584	hsa-miR-4663	CLIP-seq
MIRT787585	hsa-miR-4682	CLIP-seq
MIRT787586	hsa-miR-4691-5p	CLIP-seq
MIRT787587	hsa-miR-4697-5p	CLIP-seq
MIRT787588	hsa-miR-4701-5p	CLIP-seq
MIRT787589	hsa-miR-4734	CLIP-seq
MIRT787590	hsa-miR-544b	CLIP-seq
MIRT787591	hsa-miR-588	CLIP-seq
MIRT787592	hsa-miR-627	CLIP-seq
MIRT787593	hsa-miR-637	CLIP-seq
MIRT787594	hsa-miR-663b	CLIP-seq
MIRT787595	hsa-miR-924	CLIP-seq
MIRT787567	hsa-miR-1200	CLIP-seq
MIRT787569	hsa-miR-1238	CLIP-seq
MIRT787581	hsa-miR-4324	CLIP-seq
MIRT787586	hsa-miR-4691-5p	CLIP-seq
MIRT787590	hsa-miR-544b	CLIP-seq
MIRT787567	hsa-miR-1200	CLIP-seq
MIRT787569	hsa-miR-1238	CLIP-seq
MIRT2172611	hsa-miR-1470	CLIP-seq
MIRT787581	hsa-miR-4324	CLIP-seq
MIRT787584	hsa-miR-4663	CLIP-seq
MIRT2172612	hsa-miR-4667-3p	CLIP-seq
MIRT787586	hsa-miR-4691-5p	CLIP-seq
MIRT787590	hsa-miR-544b	CLIP-seq
MIRT787567	hsa-miR-1200	CLIP-seq
MIRT787569	hsa-miR-1238	CLIP-seq
MIRT2384272	hsa-miR-3153	CLIP-seq
MIRT787581	hsa-miR-4324	CLIP-seq
MIRT2384273	hsa-miR-4646-5p	CLIP-seq
MIRT787584	hsa-miR-4663	CLIP-seq
MIRT2384274	hsa-miR-4668-5p	CLIP-seq
MIRT787586	hsa-miR-4691-5p	CLIP-seq
MIRT787590	hsa-miR-544b	CLIP-seq
MIRT787567	hsa-miR-1200	CLIP-seq
MIRT787569	hsa-miR-1238	CLIP-seq
MIRT2475596	hsa-miR-1247	CLIP-seq
MIRT2475597	hsa-miR-1908	CLIP-seq
MIRT2475598	hsa-miR-3064-3p	CLIP-seq
MIRT2475599	hsa-miR-3151	CLIP-seq
MIRT2475600	hsa-miR-3175	CLIP-seq
MIRT2475601	hsa-miR-3180	CLIP-seq
MIRT2475602	hsa-miR-3180-3p	CLIP-seq
MIRT2475603	hsa-miR-3196	CLIP-seq
MIRT2475604	hsa-miR-3197	CLIP-seq
MIRT2475605	hsa-miR-3929	CLIP-seq
MIRT2475606	hsa-miR-3960	CLIP-seq
MIRT787581	hsa-miR-4324	CLIP-seq
MIRT2475607	hsa-miR-4419b	CLIP-seq
MIRT2475608	hsa-miR-4447	CLIP-seq
MIRT2475609	hsa-miR-4467	CLIP-seq
MIRT2475610	hsa-miR-4472	CLIP-seq
MIRT2475611	hsa-miR-4478	CLIP-seq
MIRT2475612	hsa-miR-455-3p	CLIP-seq
MIRT2475613	hsa-miR-4645-5p	CLIP-seq
MIRT787584	hsa-miR-4663	CLIP-seq
MIRT2475614	hsa-miR-4673	CLIP-seq
MIRT2475615	hsa-miR-4690-3p	CLIP-seq
MIRT787586	hsa-miR-4691-5p	CLIP-seq
MIRT2475616	hsa-miR-4706	CLIP-seq
MIRT2475617	hsa-miR-4749-5p	CLIP-seq
MIRT2475618	hsa-miR-491-5p	CLIP-seq
MIRT787590	hsa-miR-544b	CLIP-seq
MIRT2475619	hsa-miR-663	CLIP-seq
MIRT2475620	hsa-miR-744	CLIP-seq
MIRT787567	hsa-miR-1200	CLIP-seq
MIRT787569	hsa-miR-1238	CLIP-seq
MIRT2475596	hsa-miR-1247	CLIP-seq
MIRT2475597	hsa-miR-1908	CLIP-seq
MIRT2475598	hsa-miR-3064-3p	CLIP-seq
MIRT2475599	hsa-miR-3151	CLIP-seq
MIRT2475600	hsa-miR-3175	CLIP-seq
MIRT2475601	hsa-miR-3180	CLIP-seq
MIRT2475602	hsa-miR-3180-3p	CLIP-seq
MIRT2475603	hsa-miR-3196	CLIP-seq
MIRT2475604	hsa-miR-3197	CLIP-seq
MIRT2475605	hsa-miR-3929	CLIP-seq
MIRT2475606	hsa-miR-3960	CLIP-seq
MIRT787581	hsa-miR-4324	CLIP-seq
MIRT2475607	hsa-miR-4419b	CLIP-seq
MIRT2475608	hsa-miR-4447	CLIP-seq
MIRT2475609	hsa-miR-4467	CLIP-seq
MIRT2475610	hsa-miR-4472	CLIP-seq
MIRT2475611	hsa-miR-4478	CLIP-seq
MIRT2475612	hsa-miR-455-3p	CLIP-seq
MIRT2475613	hsa-miR-4645-5p	CLIP-seq
MIRT787584	hsa-miR-4663	CLIP-seq
MIRT2475614	hsa-miR-4673	CLIP-seq
MIRT2475615	hsa-miR-4690-3p	CLIP-seq
MIRT787586	hsa-miR-4691-5p	CLIP-seq
MIRT2475616	hsa-miR-4706	CLIP-seq
MIRT2475617	hsa-miR-4749-5p	CLIP-seq
MIRT2475618	hsa-miR-491-5p	CLIP-seq
MIRT787590	hsa-miR-544b	CLIP-seq
MIRT2475619	hsa-miR-663	CLIP-seq
MIRT2475620	hsa-miR-744	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	15598649, 16902404, 22262466, 22323290, 23676497, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IBA	21873635
GO:0008289	Function	Lipid binding	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0019901	Function	Protein kinase binding	ISS
GO:0030122	Component	AP-2 adaptor complex	IBA	21873635
GO:0030122	Component	AP-2 adaptor complex	IDA	23676497
GO:0030122	Component	AP-2 adaptor complex	TAS	12121421
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032802	Process	Low-density lipoprotein particle receptor catabolic process	TAS
GO:0034383	Process	Low-density lipoprotein particle clearance	TAS
GO:0035615	Function	Clathrin adaptor activity	IBA	21873635
GO:0035615	Function	Clathrin adaptor activity	TAS	12121421
GO:0036020	Component	Endolysosome membrane	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045334	Component	Clathrin-coated endocytic vesicle	NAS	25898166
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061024	Process	Membrane organization	TAS
GO:0072583	Process	Clathrin-dependent endocytosis	IBA	21873635
GO:0072583	Process	Clathrin-dependent endocytosis	IDA	23676497
GO:0072583	Process	Clathrin-dependent endocytosis	IMP	22262466
GO:0072583	Process	Clathrin-dependent endocytosis	TAS	12121421
GO:0097718	Function	Disordered domain specific binding	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:0140312	Function	Cargo adaptor activity	IBA	21873635

Other IDs

• MIM: 607242
• HGNC: 562
• e!Ensembl: ENSG00000183020

Protein

• UniProt ID: O94973
• Protein name: AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain)
• Protein function: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be invo
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01602	Adaptin_N	29 → 590	Adaptin N terminal region	Family
  PF02883	Alpha_adaptinC2	713 → 821	Adaptin C-terminal domain	Domain
  PF02296	Alpha_adaptin_C	826 → 934	Alpha adaptin AP2, C-terminal domain	Family

• Sequence:

  MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
  KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
  ASRNPTFMGLALHCIASVGSREMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSP
  DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
  STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLTECLETILNKAQEPPKSKKVQ
  HSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEF
  SHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSIR
  EEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAK
  TVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRALL
  LSTYIKFVNLFPEVKPTIQDVLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLEE
  MPPFPERESSILAKLKKKKGPSTVTDLEDTKRDRSVDVNGGPEPAPASTSAVSTPSPSAD
  LLGLGAAPPAPAGPPPSSGGSGLLVDVFSDSASVVAPLAPGSEDNFARFVCKNNGVLFEN
  QLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNLNLQTKPVDPTVEG
  GAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQR
  WKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQ
  IGCLLRLEPNLQAQMYRLTLRTSKEAVSQRLCELLSAQF

• Sequence length: 939

Pathways

KEGG:

Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington disease

Reactome:

Nef Mediated CD4 Down-regulation
Retrograde neurotrophin signalling
Nef Mediated CD8 Down-regulation
MHC class II antigen presentation
EPH-ephrin mediated repulsion of cells
Trafficking of GluR2-containing AMPA receptors
Recycling pathway of L1
WNT5A-dependent internalization of FZD4
WNT5A-dependent internalization of FZD2, FZD5 and ROR2
Neutrophil degranulation
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
VLDLR internalisation and degradation
LDL clearance

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	24162737
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	27611488