GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

DGKQ (diacylglycerol kinase theta)

Gene

1609

Diacylglycerol kinase theta

DGKQ

DAGK, DAGK4, DAGK7

4p16.3

The protein encoded by this gene contains three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain. It is localized in the speckle domains of the nucleus, and mediates the regeneration

Show/Hide all(118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT934242	hsa-miR-1228	CLIP-seq
MIRT934243	hsa-miR-1237	CLIP-seq
MIRT934244	hsa-miR-1286	CLIP-seq
MIRT934245	hsa-miR-1292	CLIP-seq
MIRT934246	hsa-miR-133a	CLIP-seq
MIRT934247	hsa-miR-133b	CLIP-seq
MIRT934248	hsa-miR-140-3p	CLIP-seq
MIRT934249	hsa-miR-1908	CLIP-seq
MIRT934250	hsa-miR-1915	CLIP-seq
MIRT934251	hsa-miR-197	CLIP-seq
MIRT934252	hsa-miR-2467-5p	CLIP-seq
MIRT934253	hsa-miR-3126-5p	CLIP-seq
MIRT934254	hsa-miR-3135b	CLIP-seq
MIRT934255	hsa-miR-3136-3p	CLIP-seq
MIRT934256	hsa-miR-3140-3p	CLIP-seq
MIRT934257	hsa-miR-3141	CLIP-seq
MIRT934258	hsa-miR-3188	CLIP-seq
MIRT934259	hsa-miR-3199	CLIP-seq
MIRT934260	hsa-miR-329	CLIP-seq
MIRT934261	hsa-miR-342-3p	CLIP-seq
MIRT934262	hsa-miR-362-3p	CLIP-seq
MIRT934263	hsa-miR-3652	CLIP-seq
MIRT934264	hsa-miR-3689d	CLIP-seq
MIRT934265	hsa-miR-370	CLIP-seq
MIRT934266	hsa-miR-377	CLIP-seq
MIRT934267	hsa-miR-3941	CLIP-seq
MIRT934268	hsa-miR-3975	CLIP-seq
MIRT934269	hsa-miR-4269	CLIP-seq
MIRT934270	hsa-miR-4281	CLIP-seq
MIRT934271	hsa-miR-4314	CLIP-seq
MIRT934272	hsa-miR-4316	CLIP-seq
MIRT934273	hsa-miR-4430	CLIP-seq
MIRT934274	hsa-miR-4436a	CLIP-seq
MIRT934275	hsa-miR-4471	CLIP-seq
MIRT934276	hsa-miR-4515	CLIP-seq
MIRT934277	hsa-miR-4646-5p	CLIP-seq
MIRT934278	hsa-miR-466	CLIP-seq
MIRT934279	hsa-miR-4672	CLIP-seq
MIRT934280	hsa-miR-4685-5p	CLIP-seq
MIRT934281	hsa-miR-4700-3p	CLIP-seq
MIRT934282	hsa-miR-4706	CLIP-seq
MIRT934283	hsa-miR-4710	CLIP-seq
MIRT934284	hsa-miR-4722-5p	CLIP-seq
MIRT934285	hsa-miR-4749-3p	CLIP-seq
MIRT934286	hsa-miR-4749-5p	CLIP-seq
MIRT934287	hsa-miR-485-3p	CLIP-seq
MIRT934288	hsa-miR-485-5p	CLIP-seq
MIRT934289	hsa-miR-603	CLIP-seq
MIRT934290	hsa-miR-663	CLIP-seq
MIRT934291	hsa-miR-885-3p	CLIP-seq
MIRT934292	hsa-miR-935	CLIP-seq
MIRT1976574	hsa-miR-193a-3p	CLIP-seq
MIRT1976575	hsa-miR-193b	CLIP-seq
MIRT1976576	hsa-miR-214	CLIP-seq
MIRT934252	hsa-miR-2467-5p	CLIP-seq
MIRT934254	hsa-miR-3135b	CLIP-seq
MIRT934255	hsa-miR-3136-3p	CLIP-seq
MIRT1976577	hsa-miR-3169	CLIP-seq
MIRT1976578	hsa-miR-3184	CLIP-seq
MIRT934258	hsa-miR-3188	CLIP-seq
MIRT1976579	hsa-miR-3619-5p	CLIP-seq
MIRT934263	hsa-miR-3652	CLIP-seq
MIRT934264	hsa-miR-3689d	CLIP-seq
MIRT1976580	hsa-miR-3690	CLIP-seq
MIRT934268	hsa-miR-3975	CLIP-seq
MIRT1976581	hsa-miR-423-5p	CLIP-seq
MIRT934269	hsa-miR-4269	CLIP-seq
MIRT934272	hsa-miR-4316	CLIP-seq
MIRT934273	hsa-miR-4430	CLIP-seq
MIRT1976582	hsa-miR-4435	CLIP-seq
MIRT1976583	hsa-miR-4477b	CLIP-seq
MIRT934276	hsa-miR-4515	CLIP-seq
MIRT1976584	hsa-miR-4688	CLIP-seq
MIRT1976585	hsa-miR-4690-5p	CLIP-seq
MIRT934283	hsa-miR-4710	CLIP-seq
MIRT1976586	hsa-miR-4716-3p	CLIP-seq
MIRT934288	hsa-miR-485-5p	CLIP-seq
MIRT1976587	hsa-miR-761	CLIP-seq
MIRT934242	hsa-miR-1228	CLIP-seq
MIRT2211939	hsa-miR-1825	CLIP-seq
MIRT1976574	hsa-miR-193a-3p	CLIP-seq
MIRT1976575	hsa-miR-193b	CLIP-seq
MIRT934252	hsa-miR-2467-5p	CLIP-seq
MIRT934254	hsa-miR-3135b	CLIP-seq
MIRT1976577	hsa-miR-3169	CLIP-seq
MIRT934258	hsa-miR-3188	CLIP-seq
MIRT934261	hsa-miR-342-3p	CLIP-seq
MIRT934263	hsa-miR-3652	CLIP-seq
MIRT934264	hsa-miR-3689d	CLIP-seq
MIRT1976580	hsa-miR-3690	CLIP-seq
MIRT934268	hsa-miR-3975	CLIP-seq
MIRT934269	hsa-miR-4269	CLIP-seq
MIRT2211940	hsa-miR-4284	CLIP-seq
MIRT934272	hsa-miR-4316	CLIP-seq
MIRT934273	hsa-miR-4430	CLIP-seq
MIRT1976582	hsa-miR-4435	CLIP-seq
MIRT2211941	hsa-miR-4457	CLIP-seq
MIRT1976583	hsa-miR-4477b	CLIP-seq
MIRT2211942	hsa-miR-4494	CLIP-seq
MIRT934276	hsa-miR-4515	CLIP-seq
MIRT934280	hsa-miR-4685-5p	CLIP-seq
MIRT1976584	hsa-miR-4688	CLIP-seq
MIRT934282	hsa-miR-4706	CLIP-seq
MIRT934283	hsa-miR-4710	CLIP-seq
MIRT1976586	hsa-miR-4716-3p	CLIP-seq
MIRT2211943	hsa-miR-4733-3p	CLIP-seq
MIRT934286	hsa-miR-4749-5p	CLIP-seq
MIRT934288	hsa-miR-485-5p	CLIP-seq
MIRT2211944	hsa-miR-486-3p	CLIP-seq
MIRT934291	hsa-miR-885-3p	CLIP-seq
MIRT2211941	hsa-miR-4457	CLIP-seq
MIRT2386877	hsa-miR-4758-3p	CLIP-seq
MIRT2436806	hsa-miR-22	CLIP-seq
MIRT2436807	hsa-miR-4742-3p	CLIP-seq
MIRT2436808	hsa-miR-4769-3p	CLIP-seq
MIRT2436806	hsa-miR-22	CLIP-seq
MIRT2436807	hsa-miR-4742-3p	CLIP-seq
MIRT2436808	hsa-miR-4769-3p	CLIP-seq

Show/Hide all(57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003951	Function	NAD+ kinase activity	IEA
GO:0004143	Function	Diacylglycerol kinase activity	IBA	21873635
GO:0004143	Function	Diacylglycerol kinase activity	IDA	9099683, 10066731, 11309392, 15632189, 22627129, 23949095
GO:0004143	Function	Diacylglycerol kinase activity	IMP	23091060
GO:0004143	Function	Diacylglycerol kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	10066731, 22732145, 23091060, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	15632189, 17664281, 23610160
GO:0005737	Component	Cytoplasm	IDA	15632189, 23610160
GO:0005768	Component	Endosome	IDA	22732145
GO:0005829	Component	Cytosol	IDA	10066731, 22627129, 23091060
GO:0005856	Component	Cytoskeleton	IDA	10066731
GO:0005886	Component	Plasma membrane	IDA	10066731, 15632189, 22732145
GO:0005886	Component	Plasma membrane	TAS
GO:0006111	Process	Regulation of gluconeogenesis	IMP	23767959
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	17664281
GO:0006654	Process	Phosphatidic acid biosynthetic process	IDA	9099683, 22732145, 23949095
GO:0006654	Process	Phosphatidic acid biosynthetic process	IMP	23610160, 23767959
GO:0007171	Process	Activation of transmembrane receptor protein tyrosine kinase activity	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	15632189
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IDA	22732145
GO:0010628	Process	Positive regulation of gene expression	IMP	24369117
GO:0010629	Process	Negative regulation of gene expression	IMP	24369117
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	IDA	22732145
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	IGI	22732145
GO:0012506	Component	Vesicle membrane	IDA	23091060
GO:0016363	Component	Nuclear matrix	ISS
GO:0016607	Component	Nuclear speck	IDA	12799190
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	23767959
GO:0019900	Function	Kinase binding	IPI	15632189
GO:0019933	Process	CAMP-mediated signaling	IDA	17664281
GO:0019933	Process	CAMP-mediated signaling	IMP	24369117
GO:0030168	Process	Platelet activation	TAS
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IGI	22732145
GO:0033198	Process	Response to ATP	IDA	15632189
GO:0033613	Function	Activating transcription factor binding	IPI	17664281
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0043274	Function	Phospholipase binding	IPI	12799190
GO:0046339	Process	Diacylglycerol metabolic process	IBA	21873635
GO:0046339	Process	Diacylglycerol metabolic process	IDA	9099683, 11309392, 22627129, 23949095
GO:0046486	Process	Glycerolipid metabolic process	IDA	22627129
GO:0046834	Process	Lipid phosphorylation	IBA	21873635
GO:0046834	Process	Lipid phosphorylation	IDA	9099683, 11309392, 22627129, 23949095
GO:0046872	Function	Metal ion binding	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	22732145
GO:0051591	Process	Response to cAMP	IDA	23610160
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	15632189
GO:0070528	Process	Protein kinase C signaling	IDA	15632189
GO:0090181	Process	Regulation of cholesterol metabolic process	IMP	24369117
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1903432	Process	Regulation of TORC1 signaling	IMP	23767959
GO:2000064	Process	Regulation of cortisol biosynthetic process	IMP	24369117
GO:2000182	Process	Regulation of progesterone biosynthetic process	IMP	24369117

MIM	HGNC	e!Ensembl
601207	2856	ENSG00000145214

Protein

UniProt ID

P52824

Protein name

Diacylglycerol kinase theta (DAG kinase theta) (DGKtheta) (EC 2.7.1.107) (EC 2.7.1.93) (Diglyceride kinase theta) (DGK-theta)

Protein function

Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids (PubMed:11309392, PubMed:22627129, PubMed:9099683). Thereby, acts as a central switc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	61 → 110	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00130	C1_1	184 → 237	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00788	RA	395 → 494	Ras association (RalGDS/AF-6) domain	Domain
PF00781	DAGK_cat	588 → 712	Diacylglycerol kinase catalytic domain	Family
PF00609	DAGK_acc	741 → 893	Diacylglycerol kinase accessory domain	Family

Sequence

MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPG
HSFRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPV
AHCFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHD
THHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLR
SLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTL
KIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAW
AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPK
STARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVR
QVSQTRFYVAESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQG
AVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGL
KGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEET
RYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSVLLSVDEADAVLMDRWTILLD
AHEAGSAENDTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYV
RVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKP
RMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGH
MIISAAGPKVHMLRKAKQKPRRAGTTRDARADAAPAPESDPR

Sequence length

942

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism Metabolic pathways Phosphatidylinositol signaling system Phospholipase D signaling pathway Choline metabolism in cancer		Effects of PIP2 hydrolysis

Associated diseases

Show/Hide Causal Diseases (2)

Causal
Disease name	Disease term	dbSNP ID	References
Parkinson disease	Parkinson Disease	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	22451204, 21738487, 22438815
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	30573655

Show/Hide Unknown Diseases (5)

Unknown
Disease name	Disease term	dbSNP ID	References
Lupus erythematosus	Lupus Erythematosus, Systemic		28714469, 30573655
Myositis	Myositis		30573655, 26362759
Biliary cirrhosis	Primary biliary cirrhosis		26394269
Scleroderma	Systemic Scleroderma		31672989, 30573655
Sjogren`s syndrome	Sicca Syndrome, Sjogren`s Syndrome		24097067

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412