CYP2C8 (cytochrome P450 family 2 subfamily C member 8)

Gene

• Entrez ID: 1558
• Gene name: Cytochrome P450 family 2 subfamily C member 8
• Gene symbol: CYP2C8
• Synonyms: CPC8, CYP2C8DM, CYPIIC8, MP-12/MP-20
• Chromosome: 10
• Chromosome location: 10q23.33
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs10509681	T>C	Drug-response, benign	Missense variant, coding sequence variant
rs72558196	T>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006955	hsa-miR-103a-3p	qRT-PCR, Western blot	22723340
MIRT006956	hsa-miR-107	qRT-PCR, Western blot	22723340
MIRT921351	hsa-miR-1	CLIP-seq
MIRT921352	hsa-miR-1257	CLIP-seq
MIRT921353	hsa-miR-206	CLIP-seq
MIRT921354	hsa-miR-3161	CLIP-seq
MIRT921355	hsa-miR-4461	CLIP-seq
MIRT921356	hsa-miR-4658	CLIP-seq
MIRT921357	hsa-miR-4699-5p	CLIP-seq
MIRT921358	hsa-miR-4727-3p	CLIP-seq
MIRT921359	hsa-miR-4747-5p	CLIP-seq
MIRT921360	hsa-miR-4758-5p	CLIP-seq
MIRT921361	hsa-miR-4765	CLIP-seq
MIRT921362	hsa-miR-4790-3p	CLIP-seq
MIRT921363	hsa-miR-613	CLIP-seq
MIRT921364	hsa-miR-633	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HNF4A	Activation	20086032
NR1I2	Unknown	18096673

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002933	Process	Lipid hydroxylation	IDA	14559847
GO:0004497	Function	Monooxygenase activity	IDA	15766564, 19651758
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006082	Process	Organic acid metabolic process	IBA	21873635
GO:0006082	Process	Organic acid metabolic process	IDA	19651758
GO:0006805	Process	Xenobiotic metabolic process	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IDA	14559847
GO:0008210	Process	Estrogen metabolic process	IDA	12865317, 14559847
GO:0008392	Function	Arachidonic acid epoxygenase activity	IBA	21873635
GO:0008392	Function	Arachidonic acid epoxygenase activity	IDA	7574697
GO:0008395	Function	Steroid hydroxylase activity	IBA	21873635
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	11093772
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	21873635
GO:0017144	Process	Drug metabolic process	IDA	19651758
GO:0019373	Process	Epoxygenase P450 pathway	IBA	21873635
GO:0019373	Process	Epoxygenase P450 pathway	IDA	7574697
GO:0019373	Process	Epoxygenase P450 pathway	TAS
GO:0020037	Function	Heme binding	IBA	21873635
GO:0034875	Function	Caffeine oxidase activity	IDA	18619574
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	11093772
GO:0042738	Process	Exogenous drug catabolic process	IBA	21873635
GO:0042738	Process	Exogenous drug catabolic process	IDA	18619574
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0046456	Process	Icosanoid biosynthetic process	IDA	15766564
GO:0070330	Function	Aromatase activity	IEA
GO:0070989	Process	Oxidative demethylation	IDA	18619574
GO:0097267	Process	Omega-hydroxylase P450 pathway	TAS
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	14559847

Other IDs

• MIM: 601129
• HGNC: 2622
• e!Ensembl: ENSG00000138115

Protein

• UniProt ID: P10632
• Protein name: Cytochrome P450 2C8 (EC 1.14.14.1) (CYPIIC8) (Cytochrome P450 IIC2) (Cytochrome P450 MP-12) (Cytochrome P450 MP-20) (Cytochrome P450 form 1) (S-mephenytoin 4-hydroxylase)
• Protein function: A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins (PubMed:11093772, PubMed:14559847, PubMed:15766564, PubMed:19965576, PubMed:7574697). Mechanistical
• PDB: 1PQ2, 2NNH, 2NNI, 2NNJ, 2VN0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	30 → 487	Cytochrome P450	Domain

• Sequence:

  MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
  YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
  KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
  VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
  RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
  TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
  LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
  KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
  PSYQICFIPV

• Sequence length: 490

Pathways

KEGG:

Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis - DNA adducts
Lipid and atherosclerosis

Reactome:

Xenobiotics
CYP2E1 reactions
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET)
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE)
Biosynthesis of maresin-like SPMs

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	18769365
Lymphoblastic leukemia	Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591	22674224

Unknown
Disease name	Disease term	dbSNP ID	References
Gout	Gout		22179738
Gouty arthritis	Arthritis, Gouty		22179738
Liver carcinoma	Liver carcinoma		28284560
Nervous system diseases	Peripheral Nervous System Diseases		27736846
Nervous system disorder	nervous system disorder		21245421