Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
152225 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
RIG-I dependent antiviral response regulator RNA |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
RDUR |
SynonymsGene synonyms aliases
|
LINC02085 |
ChromosomeChromosome number
|
3 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
3q12.3 |
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
GO ID |
Ontology |
Definition |
Evidence |
Reference |
GO:0005515 |
Function |
Protein binding |
IPI |
32814053 |
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q0VG73 |
Protein name |
Putative protein RDUR (RIG-I dependent antiviral response regulator RNA) |
Protein function |
Could play a role in innate immunity against viruses. |
Family and domains |
|
Sequence |
MNNSFNKEDRMSSDTMVGSCDRQTKNGAKWHGGVSSLLDFTLIYIQLSTSFQNAGHSFKK QHICSDFEVMDELSCAVYGNKFYYLLPTLTHPSIQ
|
|
Sequence length |
95 |
Interactions |
View interactions |
Associated diseases
|
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Anxiety disorder |
Anxiety Disorders |
|
31619474, 26754954 |
Psoriasis vulgaris |
Psoriasis vulgaris |
|
26626624 |
|