GediPNet logo

CTLA4 (cytotoxic T-lymphocyte associated protein 4)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1493
Gene nameGene Name - the full gene name approved by the HGNC.
Cytotoxic T-lymphocyte associated protein 4
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CTLA4
SynonymsGene synonyms aliases
ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, enco
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs231775 A>G,T Benign, risk-factor Coding sequence variant, missense variant
rs3087243 G>A Risk-factor Downstream transcript variant
rs606231417 C>T Pathogenic Stop gained, coding sequence variant
rs606231418 G>- Pathogenic Coding sequence variant, frameshift variant
rs606231419 G>C Pathogenic Intron variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004436 hsa-miR-155-5p Microarray 19193853
MIRT049319 hsa-miR-92a-3p CLASH 23622248
MIRT503700 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT503699 hsa-miR-190a-3p HITS-CLIP 21572407
MIRT503698 hsa-miR-3924 HITS-CLIP 21572407
Transcription factors
Transcription factor Regulation Reference
LEF1 Unknown 16297665
MSC Activation 19561533
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0005515 Function Protein binding IPI 7807015, 9398332, 9813138, 11279501, 11279502, 20587542, 21982860, 25241761, 32296183
GO:0005794 Component Golgi apparatus IDA 15814706
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IMP 28484017
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P16410
Protein name Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4) (CTLA-4) (CD antigen CD152)
Protein function Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. {ECO:0
PDB 1AH1 , 1H6E , 1I85 , 1I8L , 2X44 , 3BX7 , 3OSK , 5GGV , 5TRU , 5XJ3 , 6RP8 , 6RPJ , 6RQM , 6XY2 , 7CIO , 7DV4 , 7ELX , 7SU0 , 7SU1 , 8GAB , 8HIT , 9DQ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set
41 152
Immunoglobulin V-set domain
Domain
Sequence
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVI
DPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Sequence length 223
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cell adhesion molecules
T cell receptor signaling pathway
Autoimmune thyroid disease
Rheumatoid arthritis
  CTLA4 inhibitory signaling
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Anemia, Hemolytic rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Arthritis Arthritis, Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Autoimmune lymphoproliferative disorder Autoimmune lymphoproliferative syndrome due to CTLA4 haploinsuffiency rs17860424, rs112445441, rs121913529, rs121434596, rs80358236, rs606231361, rs606231362, rs121913076, rs606231363, rs121913077, rs28929498, rs121913080, rs267607122, rs606231364, rs606231365, rs121913085, rs606231366, rs121913086, rs121913237, rs121913535, rs398122958, rs606231296, rs886039524, rs121913527, rs1554851718, rs1295207359, rs1564699214, rs1564686301, rs1564696849, rs1564691414, rs747862347, rs1589482683, rs1589488463, rs1589488640, rs1589488494, rs1589465172, rs1589478691, rs1589485636, rs778993919, rs1842954041, rs1848315820, rs1207744817, rs1848558128, rs1848671126, rs1848675068, rs1848019699
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia
Alopecia areata Alopecia Areata 25608926, 20596022
Autoimmune hemolytic anemia Autoimmune hemolytic anemia
Bipolar disorder Bipolar Disorder 21040781, 14678452

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412