CREB3L4 (cAMP responsive element binding protein 3 like 4)

Gene

• Entrez ID: 148327
• Gene name: CAMP responsive element binding protein 3 like 4
• Gene symbol: CREB3L4
• Synonyms: AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT908896	hsa-let-7a	CLIP-seq
MIRT908897	hsa-let-7b	CLIP-seq
MIRT908898	hsa-let-7c	CLIP-seq
MIRT908899	hsa-let-7d	CLIP-seq
MIRT908900	hsa-let-7e	CLIP-seq
MIRT908901	hsa-let-7f	CLIP-seq
MIRT908902	hsa-let-7g	CLIP-seq
MIRT908903	hsa-let-7i	CLIP-seq
MIRT908904	hsa-miR-1229	CLIP-seq
MIRT908905	hsa-miR-1304	CLIP-seq
MIRT908906	hsa-miR-1323	CLIP-seq
MIRT908907	hsa-miR-202	CLIP-seq
MIRT908908	hsa-miR-3679-3p	CLIP-seq
MIRT908909	hsa-miR-371b-5p	CLIP-seq
MIRT908910	hsa-miR-4458	CLIP-seq
MIRT908911	hsa-miR-4500	CLIP-seq
MIRT908912	hsa-miR-548ad	CLIP-seq
MIRT908913	hsa-miR-548o	CLIP-seq
MIRT908914	hsa-miR-888	CLIP-seq
MIRT908915	hsa-miR-98	CLIP-seq
MIRT2205510	hsa-miR-125a-5p	CLIP-seq
MIRT2205511	hsa-miR-125b	CLIP-seq
MIRT2205512	hsa-miR-3163	CLIP-seq
MIRT2205513	hsa-miR-3166	CLIP-seq
MIRT2205514	hsa-miR-3616-3p	CLIP-seq
MIRT2205515	hsa-miR-4269	CLIP-seq
MIRT2205516	hsa-miR-4319	CLIP-seq
MIRT2205517	hsa-miR-4436b-3p	CLIP-seq
MIRT2205518	hsa-miR-4509	CLIP-seq
MIRT2205519	hsa-miR-4514	CLIP-seq
MIRT2205520	hsa-miR-4520b-3p	CLIP-seq
MIRT2205521	hsa-miR-4529-3p	CLIP-seq
MIRT2205522	hsa-miR-4535	CLIP-seq
MIRT2205523	hsa-miR-4668-3p	CLIP-seq
MIRT2205524	hsa-miR-4692	CLIP-seq
MIRT2205525	hsa-miR-4721	CLIP-seq
MIRT2205526	hsa-miR-4742-5p	CLIP-seq
MIRT2205527	hsa-miR-4747-5p	CLIP-seq
MIRT2205528	hsa-miR-4776-5p	CLIP-seq
MIRT2205529	hsa-miR-544b	CLIP-seq
MIRT2205530	hsa-miR-562	CLIP-seq
MIRT2205531	hsa-miR-711	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	16236796
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007283	Process	Spermatogenesis	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035497	Function	CAMP response element binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16236796
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 607138
• HGNC: 18854
• e!Ensembl: ENSG00000143578

Protein

• UniProt ID: Q8TEY5
• Protein name: Cyclic AMP-responsive element-binding protein 3-like protein 4 (cAMP-responsive element-binding protein 3-like protein 4) (Androgen-induced basic leucine zipper protein) (AIbZIP) (Attaching to CRE-like 1) (ATCE1) (Cyclic AMP-responsive element-binding pro
• Protein function: Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional acti
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	215 → 291	bZIP transcription factor	Coiled-coil

• Sequence:

  MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
  QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
  ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
  LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
  YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
  LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
  GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM

• Sequence length: 395

Pathways

KEGG:

cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Thermogenesis
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Insulin resistance
Cushing syndrome
Growth hormone synthesis, secretion and action
Vasopressin-regulated water reabsorption
Huntington disease
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
Prostate cancer

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	27415467

Unknown
Disease name	Disease term	dbSNP ID	References
Prostatic neoplasms	Prostatic Neoplasms		27415467