GediPNet logo

CCBE1 (collagen and calcium binding EGF domains 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
147372
Gene nameGene Name - the full gene name approved by the HGNC.
Collagen and calcium binding EGF domains 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CCBE1
SynonymsGene synonyms aliases
HKLLS1
ChromosomeChromosome number
18
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.32
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61745250 G>A Conflicting-interpretations-of-pathogenicity, benign Coding sequence variant, non coding transcript variant, synonymous variant, missense variant
rs121908250 A>T Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs121908251 C>G Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs121908252 C>G Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs121908253 G>A,C Uncertain-significance, pathogenic Missense variant, non coding transcript variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT721095 hsa-miR-584-3p HITS-CLIP 19536157
MIRT721094 hsa-miR-4277 HITS-CLIP 19536157
MIRT721093 hsa-miR-3183 HITS-CLIP 19536157
MIRT721092 hsa-miR-4723-3p HITS-CLIP 19536157
MIRT721091 hsa-miR-6769b-3p HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001946 Process Lymphangiogenesis IMP 19935664
GO:0001946 Process Lymphangiogenesis ISS
GO:0002020 Function Protease binding IPI 24552833
GO:0002040 Process Sprouting angiogenesis ISS
GO:0003016 Process Respiratory system process IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q6UXH8
Protein name Collagen and calcium-binding EGF domain-containing protein 1 (Full of fluid protein homolog)
Protein function Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07645 EGF_CA
134 174
Calcium-binding EGF domain
Domain
PF01391 Collagen
245 293
Collagen triple helix repeat (20 copies)
Repeat
Sequence
MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCL
KSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYD
RERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKY
PNDTGHEKSENMVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLA
SNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQG
RRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHR
THSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Sequence length 406
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074, rs267606903, rs121912677, rs387906585, rs387906773, rs72554028, rs587782928, rs587782929, rs587782930, rs587784067, rs1555226315, rs879253754, rs1114167356, rs773922431, rs1554093487, rs1554093433, rs1554093461, rs1561621507, rs1561619801, rs766692577, rs1581108237, rs1581111034, rs1579663872, rs1583066622, rs1456289029, rs1761430125
Coronal craniosynostosis Coronal craniosynostosis rs1566992093
Craniosynostosis Craniosynostosis rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs281865153, rs281865154, rs864321680, rs864321681, rs1057517670, rs1085307122, rs1064794325, rs1884302, rs1555750816, rs1599823350
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Unknown
Disease name Disease term dbSNP ID References
Benign neoplasm of nervous system Benign neoplasm of central nervous system
Congenital arteriovenous malformation Congenital arteriovenous malformation
Congenital camptodactyly Congenital Camptodactyly
Congenital clubfoot Congenital clubfoot

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412