CD300LF (CD300 molecule like family member f)

Gene

• Entrez ID: 146722
• Gene name: CD300 molecule like family member f
• Gene symbol: CD300LF
• Synonyms: CD300f, CLM-1, CLM1, IREM-1, IREM1, IgSF13, LMIR3, NKIR
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT874949	hsa-miR-1299	CLIP-seq
MIRT874950	hsa-miR-132	CLIP-seq
MIRT874951	hsa-miR-194	CLIP-seq
MIRT874952	hsa-miR-204	CLIP-seq
MIRT874953	hsa-miR-211	CLIP-seq
MIRT874954	hsa-miR-212	CLIP-seq
MIRT874955	hsa-miR-28-5p	CLIP-seq
MIRT874956	hsa-miR-3128	CLIP-seq
MIRT874957	hsa-miR-3130-3p	CLIP-seq
MIRT874958	hsa-miR-3139	CLIP-seq
MIRT874959	hsa-miR-3612	CLIP-seq
MIRT874960	hsa-miR-3670	CLIP-seq
MIRT874961	hsa-miR-4443	CLIP-seq
MIRT874962	hsa-miR-4446-5p	CLIP-seq
MIRT874963	hsa-miR-4704-3p	CLIP-seq
MIRT874964	hsa-miR-4720-5p	CLIP-seq
MIRT874965	hsa-miR-4727-5p	CLIP-seq
MIRT874966	hsa-miR-4755-5p	CLIP-seq
MIRT874967	hsa-miR-4769-3p	CLIP-seq
MIRT874968	hsa-miR-4782-5p	CLIP-seq
MIRT874969	hsa-miR-4793-3p	CLIP-seq
MIRT874970	hsa-miR-4799-3p	CLIP-seq
MIRT874971	hsa-miR-513a-5p	CLIP-seq
MIRT874972	hsa-miR-516b	CLIP-seq
MIRT874973	hsa-miR-544	CLIP-seq
MIRT874974	hsa-miR-548ag	CLIP-seq
MIRT874975	hsa-miR-548ai	CLIP-seq
MIRT874976	hsa-miR-623	CLIP-seq
MIRT874977	hsa-miR-650	CLIP-seq
MIRT874978	hsa-miR-665	CLIP-seq
MIRT874979	hsa-miR-708	CLIP-seq
MIRT874952	hsa-miR-204	CLIP-seq
MIRT874953	hsa-miR-211	CLIP-seq
MIRT874957	hsa-miR-3130-3p	CLIP-seq
MIRT874965	hsa-miR-4727-5p	CLIP-seq
MIRT874967	hsa-miR-4769-3p	CLIP-seq
MIRT874969	hsa-miR-4793-3p	CLIP-seq
MIRT874973	hsa-miR-544	CLIP-seq
MIRT2196427	hsa-miR-1207-5p	CLIP-seq
MIRT2196428	hsa-miR-4446-3p	CLIP-seq
MIRT2196429	hsa-miR-4492	CLIP-seq
MIRT2196430	hsa-miR-4498	CLIP-seq
MIRT2196431	hsa-miR-4528	CLIP-seq
MIRT2196432	hsa-miR-4763-3p	CLIP-seq
MIRT2196433	hsa-miR-762	CLIP-seq
MIRT2196427	hsa-miR-1207-5p	CLIP-seq
MIRT2385739	hsa-miR-1909	CLIP-seq
MIRT2196428	hsa-miR-4446-3p	CLIP-seq
MIRT2196429	hsa-miR-4492	CLIP-seq
MIRT2196430	hsa-miR-4498	CLIP-seq
MIRT2196432	hsa-miR-4763-3p	CLIP-seq
MIRT2385740	hsa-miR-486-3p	CLIP-seq
MIRT2196433	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005136	Function	Interleukin-4 receptor binding	ISS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IDA	24035150
GO:0034125	Process	Negative regulation of MyD88-dependent toll-like receptor signaling pathway	IMP	22043923
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IMP	22043923
GO:0035772	Process	Interleukin-13-mediated signaling pathway	ISS
GO:0050776	Process	Regulation of immune response	TAS
GO:0097001	Function	Ceramide binding	IDA	24035150
GO:1902216	Process	Positive regulation of interleukin-4-mediated signaling pathway	ISS
GO:2000426	Process	Negative regulation of apoptotic cell clearance	ISS
GO:2000427	Process	Positive regulation of apoptotic cell clearance	ISS

Other IDs

• MIM: 609807
• HGNC: 29883
• e!Ensembl: ENSG00000186074

Protein

• UniProt ID: Q8TDQ1
• Protein name: CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Immune receptor expressed on myeloid cells 1) (IREM-1) (Immunoglobulin superfamily member 13) (IgSF13) (NK inhibitory receptor) (CD antigen CD300f)
• Protein function: Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731). Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is exp
• PDB: 2NMS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	23 → 126	Immunoglobulin V-set domain	Domain
  PF15330	SIT	157 → 259		Family

• Sequence:

  MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWR
  DCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVT
  VQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRM
  MKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMA
  SLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP

• Sequence length: 290

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778