CD300LF (CD300 molecule like family member f)

Gene

• Entrez ID: 146722
• Gene name: CD300 molecule like family member f
• Gene symbol: CD300LF
• Synonyms: CD300f, CLM-1, CLM1, IREM-1, IREM1, IgSF13, LMIR3, NKIR
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005136	Function	Interleukin-4 receptor binding	ISS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IDA	24035150
GO:0034125	Process	Negative regulation of MyD88-dependent toll-like receptor signaling pathway	IMP	22043923
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IMP	22043923
GO:0035772	Process	Interleukin-13-mediated signaling pathway	ISS
GO:0050776	Process	Regulation of immune response	TAS
GO:0097001	Function	Ceramide binding	IDA	24035150
GO:1902216	Process	Positive regulation of interleukin-4-mediated signaling pathway	ISS
GO:2000426	Process	Negative regulation of apoptotic cell clearance	ISS
GO:2000427	Process	Positive regulation of apoptotic cell clearance	ISS

Other IDs

• MIM: 609807
• HGNC: 29883
• e!Ensembl: ENSG00000186074

Protein

• UniProt ID: Q8TDQ1
• Protein name: CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Immune receptor expressed on myeloid cells 1) (IREM-1) (Immunoglobulin superfamily member 13) (IgSF13) (NK inhibitory receptor) (CD antigen CD300f)
• Protein function: Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731). Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (By similarity). Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands (PubMed:24035150). May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (By similarity). Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:22043923). Inhibits osteoclast formation. Induces macrophage cell death upon engagement (By similarity).
• PDB: 2NMS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	23 → 126	Immunoglobulin V-set domain	Domain
  PF15330	SIT	157 → 259		Family

• Sequence:

  MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWR
  DCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVT
  VQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRM
  MKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMA
  SLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP

• Sequence length: 290

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778