CSK (C-terminal Src kinase)

Gene

• Entrez ID: 1445
• Gene name: C-terminal Src kinase
• Gene symbol: CSK
• Synonyms: -
• Chromosome: 15
• Chromosome location: 15q24.1
• Summary: The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003960	hsa-miR-140-5p	Microarray	17875710
MIRT030606	hsa-miR-24-3p	Microarray	19748357
MIRT035928	hsa-miR-1180-3p	CLASH	23622248
MIRT755804	hsa-miR-192-3p	Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay	36914869
MIRT911892	hsa-miR-1225-5p	CLIP-seq
MIRT911893	hsa-miR-1302	CLIP-seq
MIRT911894	hsa-miR-130a	CLIP-seq
MIRT911895	hsa-miR-130b	CLIP-seq
MIRT911896	hsa-miR-148a	CLIP-seq
MIRT911897	hsa-miR-148b	CLIP-seq
MIRT911898	hsa-miR-151-5p	CLIP-seq
MIRT911899	hsa-miR-151b	CLIP-seq
MIRT911900	hsa-miR-152	CLIP-seq
MIRT911901	hsa-miR-2110	CLIP-seq
MIRT911902	hsa-miR-2467-5p	CLIP-seq
MIRT911903	hsa-miR-301a	CLIP-seq
MIRT911904	hsa-miR-301b	CLIP-seq
MIRT911905	hsa-miR-3150b-3p	CLIP-seq
MIRT911906	hsa-miR-3188	CLIP-seq
MIRT911907	hsa-miR-342-3p	CLIP-seq
MIRT911908	hsa-miR-346	CLIP-seq
MIRT911909	hsa-miR-365	CLIP-seq
MIRT911910	hsa-miR-3656	CLIP-seq
MIRT911911	hsa-miR-3660	CLIP-seq
MIRT911912	hsa-miR-3662	CLIP-seq
MIRT911913	hsa-miR-3666	CLIP-seq
MIRT911914	hsa-miR-3682-5p	CLIP-seq
MIRT911915	hsa-miR-3975	CLIP-seq
MIRT911916	hsa-miR-4271	CLIP-seq
MIRT911917	hsa-miR-4279	CLIP-seq
MIRT911918	hsa-miR-4295	CLIP-seq
MIRT911919	hsa-miR-4298	CLIP-seq
MIRT911920	hsa-miR-4457	CLIP-seq
MIRT911921	hsa-miR-4462	CLIP-seq
MIRT911922	hsa-miR-4526	CLIP-seq
MIRT911923	hsa-miR-454	CLIP-seq
MIRT911924	hsa-miR-4641	CLIP-seq
MIRT911925	hsa-miR-4725-3p	CLIP-seq
MIRT911926	hsa-miR-4731-5p	CLIP-seq
MIRT911927	hsa-miR-4732-3p	CLIP-seq
MIRT911928	hsa-miR-4750	CLIP-seq
MIRT911929	hsa-miR-4784	CLIP-seq
MIRT911930	hsa-miR-485-5p	CLIP-seq
MIRT911931	hsa-miR-513b	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911933	hsa-miR-578	CLIP-seq
MIRT911934	hsa-miR-602	CLIP-seq
MIRT911935	hsa-miR-643	CLIP-seq
MIRT911936	hsa-miR-885-3p	CLIP-seq
MIRT911894	hsa-miR-130a	CLIP-seq
MIRT911895	hsa-miR-130b	CLIP-seq
MIRT911896	hsa-miR-148a	CLIP-seq
MIRT911897	hsa-miR-148b	CLIP-seq
MIRT911898	hsa-miR-151-5p	CLIP-seq
MIRT911899	hsa-miR-151b	CLIP-seq
MIRT911900	hsa-miR-152	CLIP-seq
MIRT911903	hsa-miR-301a	CLIP-seq
MIRT911904	hsa-miR-301b	CLIP-seq
MIRT911905	hsa-miR-3150b-3p	CLIP-seq
MIRT911937	hsa-miR-342-5p	CLIP-seq
MIRT911913	hsa-miR-3666	CLIP-seq
MIRT911918	hsa-miR-4295	CLIP-seq
MIRT911921	hsa-miR-4462	CLIP-seq
MIRT911923	hsa-miR-454	CLIP-seq
MIRT911938	hsa-miR-4664-5p	CLIP-seq
MIRT911929	hsa-miR-4784	CLIP-seq
MIRT911934	hsa-miR-602	CLIP-seq
MIRT1970311	hsa-miR-4417	CLIP-seq
MIRT1970312	hsa-miR-4437	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911924	hsa-miR-4641	CLIP-seq
MIRT2509566	hsa-miR-4758-3p	CLIP-seq
MIRT2509567	hsa-miR-552	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7507203, 10026153, 10790433, 14665621, 15683240, 17911601, 18070987, 18614016, 19167335, 21930792, 28514442, 31980649, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	8890164
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IPI	10790433
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0006468	Process	Protein phosphorylation	TAS	1945408
GO:0007420	Process	Brain development	IEA
GO:0008022	Function	Protein C-terminus binding	TAS	8890164
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0033673	Process	Negative regulation of kinase activity	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	17911601
GO:0034332	Process	Adherens junction organization	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	19888460
GO:0042997	Process	Negative regulation of Golgi to plasma membrane protein transport	IDA	20605918
GO:0043406	Process	Positive regulation of MAP kinase activity	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0046777	Process	Protein autophosphorylation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050765	Process	Negative regulation of phagocytosis	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0060368	Process	Regulation of Fc receptor mediated stimulatory signaling pathway	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070064	Function	Proline-rich region binding	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA

Other IDs

• MIM: 124095
• HGNC: 2444
• e!Ensembl: ENSG00000103653

Protein

• UniProt ID: P41240
• Protein name: Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL)
• Protein function: Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) inc
• PDB: 1BYG, 1CSK, 3D7T, 3D7U, 3EAC, 3EAZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	15 → 62	SH3 domain	Domain
  PF00017	SH2	82 → 156	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	195 → 440	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
  PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
  SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
  DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
  TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
  AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
  KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
  NCWHLDAAMRPSFLQLREQLEHIKTHELHL

• Sequence length: 450

Pathways

KEGG:

Epithelial cell signaling in Helicobacter pylori infection

Reactome:

GAB1 signalosome
Phosphorylation of CD3 and TCR zeta chains
Integrin signaling
PD-1 signaling
MAP2K and MAPK activation
Signaling by moderate kinase activity BRAF mutants
Signaling by high-kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
Paradoxical activation of RAF signaling by kinase inactive BRAF
Signaling downstream of RAS mutants

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	30525989
Lung carcinoma	Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	28604730

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary heart disease	Coronary heart disease	rs9289231, rs281864746	21347282
Lupus erythematosus	Lupus Erythematosus, Systemic		23042117
Nonbacterial verrucal endocardiosis	Libman-Sacks Disease		23042117
Scleroderma	Systemic Scleroderma		31672989