CRP (C-reactive protein)

Gene

• Entrez ID: 1401
• Gene name: C-reactive protein
• Gene symbol: CRP
• Synonyms: PTX1
• Chromosome: 1
• Chromosome location: 1q23.2
• Summary: The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern recognition molecules, but also complement regulation via recruitment of complement regulators. The encoded protein has a calcium dependent ligand binding domain with a distinctive flattened beta-jellyroll structure. It exists in two forms as either a pentamer in circulation or as a nonsoluble monomer in tissues. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection. [provided by RefSeq, Aug 2020]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735890	hsa-miR-1184	PAR-CLIP	26701625
MIRT736816	hsa-miR-1273g-3p	PAR-CLIP	26701625
MIRT743326	hsa-miR-4252	PAR-CLIP	26701625
MIRT744150	hsa-miR-4418	PAR-CLIP	26701625
MIRT749667	hsa-miR-509-3-5p	PAR-CLIP	26701625
MIRT749703	hsa-miR-509-5p	PAR-CLIP	26701625
MIRT759268	hsa-miR-7156-3p	PAR-CLIP	26701625

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Activation	12667216;23361365
FOS	Unknown	18292576
HNF1A	Unknown	18292576;8703909
NFKB1	Activation	12667216;17704137
NFKB1	Unknown	17513780
REL	Unknown	18684932
RELA	Activation	12667216;17704137
RELA	Unknown	17513780
STAT3	Activation	12667216;20978825;23361365
STAT3	Unknown	18292576
TBP	Unknown	18684932

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001849	Function	Complement component C1q complex binding	IBA	21873635
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0005509	Function	Calcium ion binding	IDA	23544079
GO:0005515	Function	Protein binding	IPI	17293598, 17339482, 17399790, 17785206, 18786923, 19084272, 19680263, 19850925, 20042240, 21037097, 21930971, 21979047, 25416956, 28533443, 29374201
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	21323571, 23544079
GO:0006953	Process	Acute-phase response	TAS	2477488
GO:0006954	Process	Inflammatory response	TAS	10408362
GO:0006958	Process	Complement activation, classical pathway	IBA	21873635
GO:0008228	Process	Opsonization	TAS	2477488
GO:0010628	Process	Positive regulation of gene expression	IDA	24141169
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	18322245
GO:0010888	Process	Negative regulation of lipid storage	IDA	18322245
GO:0030169	Function	Low-density lipoprotein particle binding	IBA	21873635
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	18322245
GO:0032677	Process	Regulation of interleukin-8 production	IDA	21037097
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	24141169
GO:0032945	Process	Negative regulation of mononuclear cell proliferation	IDA	29202702
GO:0033265	Function	Choline binding	TAS	2477488
GO:0042310	Process	Vasoconstriction	IDA	24141169
GO:0042310	Process	Vasoconstriction	IMP	24141169
GO:0042802	Function	Identical protein binding	IPI	16642000, 18786923, 19084272, 19680263, 19850925
GO:0044793	Process	Negative regulation by host of viral process	IBA	21873635
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0046790	Function	Virion binding	IDA	23544079
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IPI	24141169
GO:0050830	Process	Defense response to Gram-positive bacterium	TAS	2477488

Other IDs

• MIM: 123260
• HGNC: 2367
• e!Ensembl: ENSG00000132693

Protein

• UniProt ID: P02741
• Protein name: C-reactive protein [Cleaved into: C-reactive protein(1-205)]
• Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
• PDB: 1B09, 1CRV, 1GNH, 1LJ7, 3L2Y, 3PVN, 3PVO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00354	Pentaxin	25 → 220	Pentaxin family	Domain

• Sequence:

  MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
  LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
  ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
  DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP

• Sequence length: 224

Pathways

Reactome:

Classical antibody-mediated complement activation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs-1, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	20012460
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs-1, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19619902, 21182750, 17490859
Hyperparathyroidism	Hyperparathyroidism, Secondary	rs28942098, rs121434262, rs-1, rs80356649, rs121434264, rs587776558, rs587776559, rs121909259, rs104893689, rs28936684, rs104893690, rs869320729, rs104893700, rs104893705, rs104893707, rs104893709, rs863223311, rs80356650, rs193922432, rs886041637, rs201633414, rs1057519419, rs766719790, rs1281361203, rs759393722, rs1342435095, rs1200458339, rs755916513, rs1586190048, rs1558280170	21350317
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963	1568518
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	24868163
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs-1, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	24042701
Myocardial infarction	Myocardial Failure	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	16360360
Periodontitis	Periodontitis	rs28937571, rs104894211, rs587777534	20011938
Hypertension	Hypertensive disease	rs13306026	20667508, 16680063, 19770776, 14620923
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	17114654
Psoriasis	Psoriasis	rs-1, rs281875215, rs587777763, rs281875213, rs281875212	12559600
Metabolic diseases	Metabolic Diseases	rs-1	19131468
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	16644639
Myocarditis	Myocarditis	rs28763965	20361910

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease, Regional enteritis	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	11339241
Atherosclerosis	Atherosclerosis	rs699947, rs59439148	16931792
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	rs121918074, rs142027794, rs148791216, rs72648927, rs71578935, rs142416150, rs199830512, rs755445214, rs150102469, rs779568205, rs907992794, rs1202130741	16360360
Coronary syndrome	Acute Coronary Syndrome	rs4986893	15966572, 23305094
Congestive heart failure	Congestive heart failure	rs2301610, rs3833910, rs12301951, rs201674674, rs186741807, rs150140412, rs786205727, rs757840030, rs552050895, rs759465783, rs201978086, rs572757800, rs1572143354, rs749160569	16360360
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	22683764, 22832853
Anxiety disorder	Anxiety Disorders, Anxiety States, Neurotic		20194079
Arsenic encephalopathy	Arsenic Encephalopathy		22521605
Autoimmune diabetes	Diabetes, Autoimmune		20012460
Cardiovascular diseases	Cardiovascular Diseases		16332659, 12876635
Carditis	Carditis		20361910
Coronary arteriosclerosis	Coronary Arteriosclerosis		24868163
Crohn`s disease of large bowel	Crohn`s disease of large bowel		11339241
Crohn`s disease of the ileum	Crohn`s disease of the ileum		11339241
Brittle diabetes mellitus	Brittle diabetes		20012460
Diabetic retinopathy	Diabetic Retinopathy		20012460
Heart diseases	Heart Diseases		17388968
Ileocolitis	IIeocolitis		11339241
Kidney failure	Kidney Failure, Chronic		19539174
Liver carcinoma	Liver carcinoma		19363144
Lung neoplasms	Lung Neoplasms		17114654
Lupus erythematosus	Lupus Erythematosus, Systemic		17718048
Myocardial ischemia	Myocardial Ischemia		11840375
Nephritis	Nephritis, Interstitial, Nephritis, Tubulointerstitial		17014549
Nonbacterial verrucal endocardiosis	Libman-Sacks Disease		17718048
Palmoplantar pustules	Pustulosis of Palms and Soles		12559600
Pericementitis	Pericementitis		20011938