GediPNet logo

CRKL (CRK like proto-oncogene, adaptor protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1399
Gene nameGene Name - the full gene name approved by the HGNC.
CRK like proto-oncogene, adaptor protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CRKL
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
22
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q11.21
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kin
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004697 hsa-miR-107 Flow, Immunoblot, Microarray, qRT-PCR 19688090
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000186 Process Activation of MAPKK activity TAS
GO:0000187 Process Activation of MAPK activity IEA
GO:0001558 Process Regulation of cell growth IEA
GO:0001568 Process Blood vessel development IEA
GO:0001655 Process Urogenital system development IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P46109
Protein name Crk-like protein
Protein function May mediate the transduction of intracellular signals.
PDB 2BZX , 2BZY , 2DBK , 2EO3 , 2LQN , 2LQW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2
14 88
SH2 domain
Domain
PF00018 SH3_1
129 175
SH3 domain
Domain
PF07653 SH3_2
239 294
Variant SH3 domain
Domain
Sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFY
KIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIF
DPQNPD
ENE
Sequence length 303
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Efferocytosis
Focal adhesion
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Growth hormone synthesis, secretion and action
Bacterial invasion of epithelial cells
Shigellosis
Yersinia infection
Human cytomegalovirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Chronic myeloid leukemia
  Frs2-mediated activation
Downstream signal transduction
MET activates RAP1 and RAC1
MET receptor recycling
Erythropoietin activates RAS
Regulation of signaling by CBL
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Aortic aneurysm Aortic Aneurysm rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953, rs794728021, rs8046180, rs797045725, rs876657852, rs878854466, rs886038978, rs746972765, rs886039303, rs886040965, rs886040966, rs886040967, rs886229659, rs1553781304, rs1060502531, rs1553795301, rs1553803235, rs1213452826, rs869025352, rs1553780501, rs1553785222, rs1382893400, rs1554841990, rs1430822242, rs1567692384, rs1576422965, rs1596712899, rs2059732940, rs2041090817, rs1439991530
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074, rs267606903, rs121912677, rs387906585, rs387906773, rs72554028, rs587782928, rs587782929, rs587782930, rs587784067, rs1555226315, rs879253754, rs1114167356, rs773922431, rs1554093487, rs1554093433, rs1554093461, rs1561621507, rs1561619801, rs766692577, rs1581108237, rs1581111034, rs1579663872, rs1583066622, rs1456289029, rs1761430125
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs120074176, rs786205019
Conotruncal anomaly face syndrome CONOTRUNCAL ANOMALY FACE SYNDROME rs28939675, rs1601294362 16399080
Unknown
Disease name Disease term dbSNP ID References
Ankyloglossia Ankyloglossia
Aortic valve insufficiency Aortic Valve Insufficiency
Arachnodactyly Arachnodactyly
Blepharophimosis Blepharophimosis

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412