CREM (cAMP responsive element modulator)

Gene

• Entrez ID: 1390
• Gene name: CAMP responsive element modulator
• Gene symbol: CREM
• Synonyms: CREM-2, ICER, hCREM-2
• Chromosome: 10
• Chromosome location: 10p11.21
• Summary: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other comple

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT909498	hsa-miR-3606	CLIP-seq
MIRT909499	hsa-miR-494	CLIP-seq
MIRT909500	hsa-miR-570	CLIP-seq
MIRT909501	hsa-let-7a	CLIP-seq
MIRT909502	hsa-let-7b	CLIP-seq
MIRT909503	hsa-let-7c	CLIP-seq
MIRT909504	hsa-let-7d	CLIP-seq
MIRT909505	hsa-let-7e	CLIP-seq
MIRT909506	hsa-let-7f	CLIP-seq
MIRT909507	hsa-let-7g	CLIP-seq
MIRT909508	hsa-let-7i	CLIP-seq
MIRT909509	hsa-miR-1	CLIP-seq
MIRT909510	hsa-miR-1200	CLIP-seq
MIRT909511	hsa-miR-129-5p	CLIP-seq
MIRT909512	hsa-miR-202	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT909514	hsa-miR-206	CLIP-seq
MIRT909515	hsa-miR-2113	CLIP-seq
MIRT909516	hsa-miR-3074-5p	CLIP-seq
MIRT909517	hsa-miR-3124-3p	CLIP-seq
MIRT909518	hsa-miR-4324	CLIP-seq
MIRT909519	hsa-miR-4458	CLIP-seq
MIRT909520	hsa-miR-4500	CLIP-seq
MIRT909521	hsa-miR-4678	CLIP-seq
MIRT909522	hsa-miR-544b	CLIP-seq
MIRT909523	hsa-miR-613	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT909525	hsa-miR-651	CLIP-seq
MIRT909526	hsa-miR-98	CLIP-seq
MIRT1969583	hsa-miR-1273g	CLIP-seq
MIRT1969584	hsa-miR-25	CLIP-seq
MIRT1969585	hsa-miR-32	CLIP-seq
MIRT1969586	hsa-miR-363	CLIP-seq
MIRT1969587	hsa-miR-367	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT1969590	hsa-miR-92a	CLIP-seq
MIRT1969591	hsa-miR-92b	CLIP-seq
MIRT2205731	hsa-miR-548ae	CLIP-seq
MIRT2205732	hsa-miR-548aj	CLIP-seq
MIRT2205733	hsa-miR-548am	CLIP-seq
MIRT2205734	hsa-miR-548x	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508798	hsa-miR-2276	CLIP-seq
MIRT2508799	hsa-miR-299-3p	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508801	hsa-miR-3688-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508804	hsa-miR-376c	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508808	hsa-miR-4300	CLIP-seq
MIRT2508809	hsa-miR-4491	CLIP-seq
MIRT2508810	hsa-miR-4657	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT2508812	hsa-miR-4789-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT2508813	hsa-miR-558	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT2508814	hsa-miR-642b	CLIP-seq
MIRT2508815	hsa-miR-920	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Activation	21757709
JUN	Activation	21757709
SP1	Activation	21757709

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12626549
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	16899810
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	12626549
GO:0003677	Function	DNA binding	NAS	7916662
GO:0005515	Function	Protein binding	IPI	21976679
GO:0005634	Component	Nucleus	NAS	8206879
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	8206879
GO:0006355	Process	Regulation of transcription, DNA-templated	NAS	7916662
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0007165	Process	Signal transduction	TAS	7916662
GO:0007275	Process	Multicellular organism development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008140	Function	CAMP response element binding protein binding	NAS	8206879
GO:0030154	Process	Cell differentiation	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA	21873635
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 123812
• HGNC: 2352
• e!Ensembl: ENSG00000095794

Protein

• UniProt ID: Q03060
• Protein name: cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)
• Protein function: Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in sperm
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02173	pKID	98 → 140	pKID domain	Family
  PF00170	bZIP_1	284 → 344	bZIP transcription factor	Coiled-coil

• Sequence:

  MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
  PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS
  YRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI
  SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
  SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
  KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

• Sequence length: 345

Pathways

KEGG:

Adrenergic signaling in cardiomyocytes

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	17374397
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919, 28067908
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	19027736
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007

Unknown
Disease name	Disease term	dbSNP ID	References
Ankylosing spondylitis	Ankylosing spondylitis		26974007
Cholangitis	Cholangitis, Sclerosing		26974007
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26974007, 28067908
Diabetic cardiomyopathy	Diabetic Angiopathies, Microangiopathy, Diabetic		25381014
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504
Ulcerative colitis	Ulcerative Colitis		26974007