ATF2 (activating transcription factor 2)

Gene

• Entrez ID: 1386
• Gene name: Activating transcription factor 2
• Gene symbol: ATF2
• Synonyms: CRE-BP1, CREB-2, CREB2, HB16, TREB7
• Chromosome: 2
• Chromosome location: 2q31.1
• Summary: This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This prote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016080	hsa-miR-374b-5p	Sequencing	20371350
MIRT019034	hsa-miR-335-5p	Microarray	18185580
MIRT031029	hsa-miR-21-5p	Microarray	18591254
MIRT031297	hsa-miR-19b-3p	Sequencing	20371350
MIRT051336	hsa-miR-15a-5p	CLASH	23622248
MIRT732803	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32476275
MIRT733466	hsa-miR-451a	Western blotting, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR	32710569
MIRT804238	hsa-miR-1226	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT804242	hsa-miR-3591-3p	CLIP-seq
MIRT804243	hsa-miR-3609	CLIP-seq
MIRT804244	hsa-miR-3663-3p	CLIP-seq
MIRT804245	hsa-miR-3941	CLIP-seq
MIRT804246	hsa-miR-4477a	CLIP-seq
MIRT804247	hsa-miR-4643	CLIP-seq
MIRT804248	hsa-miR-466	CLIP-seq
MIRT804249	hsa-miR-4672	CLIP-seq
MIRT804250	hsa-miR-4729	CLIP-seq
MIRT804251	hsa-miR-4789-3p	CLIP-seq
MIRT804252	hsa-miR-545	CLIP-seq
MIRT804253	hsa-miR-548ah	CLIP-seq
MIRT804254	hsa-miR-548n	CLIP-seq
MIRT804255	hsa-miR-548t	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT804258	hsa-miR-634	CLIP-seq
MIRT804259	hsa-miR-802	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT2177152	hsa-miR-502-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT2480442	hsa-miR-3688-3p	CLIP-seq
MIRT2480443	hsa-miR-4261	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT2480444	hsa-miR-4694-3p	CLIP-seq
MIRT2480445	hsa-miR-4738-3p	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT2480446	hsa-miR-522	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
NR3C1	Repression	17016446
RB1	Unknown	7702750
SP1	Unknown	2145272

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	23729669
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	2516827
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IC	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731, 18671972, 19861239
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0004402	Function	Histone acetyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	8440710, 9748258, 10327051, 15105425, 15916964, 16511568, 18397884, 20102225, 20116378, 20195357, 20511396, 22439931, 24705354, 25416956, 25609649, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	8798441, 18397884, 19861239, 21098032, 22304920
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22304920
GO:0005741	Component	Mitochondrial outer membrane	IDA	22304920
GO:0006355	Process	Regulation of transcription, DNA-templated	IMP	22304920
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	19861239
GO:0006970	Process	Response to osmotic stress	IDA	21098032
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	22304920
GO:0006974	Process	Cellular response to DNA damage stimulus	IMP	15916964
GO:0008140	Function	CAMP response element binding protein binding	IDA	19861239
GO:0009414	Process	Response to water deprivation	IEA
GO:0010485	Function	H4 histone acetyltransferase activity	IDA	10821277
GO:0010628	Process	Positive regulation of gene expression	IMP	28977001
GO:0016525	Process	Negative regulation of angiogenesis	IMP	28977001
GO:0019901	Function	Protein kinase binding	IPI	21098032
GO:0031573	Process	Intra-S DNA damage checkpoint	IMP	15916964
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0035497	Function	CAMP response element binding	IBA	21873635
GO:0035497	Function	CAMP response element binding	IDA	19861239, 23729669
GO:0035861	Component	Site of double-strand break	IDA	15916964
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043967	Process	Histone H4 acetylation	IDA	10821277
GO:0043969	Process	Histone H2B acetylation	IDA	10821277
GO:0044013	Function	H2B histone acetyltransferase activity	IDA	10821277
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731, 18671972
GO:0046872	Function	Metal ion binding	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	10821277
GO:0060612	Process	Adipose tissue development	IEA
GO:0097186	Process	Amelogenesis	IEA
GO:0110024	Process	Positive regulation of cardiac muscle myoblast proliferation	IDA	22982025
GO:1902110	Process	Positive regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	22304920
GO:1902562	Component	H4 histone acetyltransferase complex	IDA	10821277
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 123811
• HGNC: 784
• e!Ensembl: ENSG00000115966

Protein

• UniProt ID: P15336
• Protein name: Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response el
• Protein function: Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequ
• PDB: 1BHI, 1T2K, 4H36, 6ZQS, 6ZR5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	350 → 413	bZIP transcription factor	Coiled-coil

• Sequence:

  MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
  DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
  SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
  SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
  HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
  GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
  RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
  TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
  ADQSTEPALSQIVMAPSSQSQPSGS

• Sequence length: 505

Pathways

KEGG:

MAPK signaling pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Thermogenesis
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Growth hormone synthesis, secretion and action
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation

Reactome:

Transcriptional activation of mitochondrial biogenesis
HATs acetylate histones
Circadian Clock
Activation of the AP-1 family of transcription factors
TP53 Regulates Transcription of DNA Repair Genes
Regulation of PTEN gene transcription
Estrogen-dependent gene expression
NGF-stimulated transcription
Response of EIF2AK4 (GCN2) to amino acid deficiency

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959

Unknown
Disease name	Disease term	dbSNP ID	References
Benign neoplasm	Benign Neoplasm		23591579
Malignant neoplasm	Malignant Neoplasms		23591579
Neoplasms	Neoplasms		23591579