GediPNet logo

CREB1 (cAMP responsive element binding protein 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1385
Gene nameGene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CREB1
SynonymsGene synonyms aliases
CREB, CREB-1
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kin
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000066 hsa-miR-34b-5p Review, Luciferase reporter assay 19461653
MIRT004766 hsa-miR-103a-3p Luciferase reporter assay, qRT-PCR, Western blot 20886090
MIRT000066 hsa-miR-34b-5p Luciferase reporter assay, qRT-PCR, Western blot 19258499
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
Transcription factors
Transcription factor Regulation Reference
ATF5 Activation 17140605
CREBBP Activation 19564345
CREM Repression 11988318
FOXO4 Activation 20136501
SP1 Unknown 17937658
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 19861239
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 9065434, 19861239
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P16220
Protein name Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)
Protein function Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters (By similarity). Transcription activation is enhanced by th
PDB 2LXT , 5ZK1 , 5ZKO , 7TBH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02173 pKID
113 153
pKID domain
Family
PF00170 bZIP_1
281 340
bZIP transcription factor
Coiled-coil
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITT
VTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
Sequence length 327
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  cGMP-PKG signaling pathway
cAMP signaling pathway
Efferocytosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Thermogenesis
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Insulin resistance
Cushing syndrome
Growth hormone synthesis, secretion and action
Vasopressin-regulated water reabsorption
Huntington disease
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
Prostate cancer
  AKT phosphorylates targets in the nucleus
CREB phosphorylation
Transcriptional activation of mitochondrial biogenesis
NCAM signaling for neurite out-growth
Circadian Clock
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
Constitutive Signaling by AKT1 E17K in Cancer
Gastrin-CREB signalling pathway via PKC and MAPK
NGF-stimulated transcription
HCMV Early Events
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Melanoma Cutaneous Melanoma, Melanoma of soft tissue rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050 29179997
Myocardial infarction Myocardial Infarction rs12316150, rs41303970, rs909253, rs7291467, rs2234693 19027736
Sarcoma Clear Cell Sarcoma of Soft Tissue rs11540652, rs104886003, rs137852790, rs1555927374 19561568
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 10570922, 25043418, 22198373
Unknown
Disease name Disease term dbSNP ID References
Bipolar disorder Bipolar Disorder 18189280, 23568192, 22386572
Histiocytoma Histiocytoma, Angiomatoid Fibrous, Histiocytoma
Mental depression Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder rs587778876, rs587778877 20643483, 21937024, 23619509, 22152193, 23269207, 25755794, 24006268, 24093582, 25059218, 23844928, 25059218, 25755794, 24006268, 24093582, 23844928
Mood disorder Mood Disorders 20957653, 23537502, 22574704, 24898566, 21807415

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412