COX7C (cytochrome c oxidase subunit 7C)

Gene

• Entrez ID: 1350
• Gene name: Cytochrome c oxidase subunit 7C
• Gene symbol: COX7C
• Synonyms: -
• Chromosome: 5
• Chromosome location: 5q14.3
• Summary: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045951	hsa-miR-125b-5p	CLASH	23622248
MIRT043481	hsa-miR-331-3p	CLASH	23622248
MIRT042980	hsa-miR-324-3p	CLASH	23622248
MIRT041272	hsa-miR-193b-3p	CLASH	23622248
MIRT905581	hsa-miR-183	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT905585	hsa-miR-598	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT2507946	hsa-miR-3928	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT2507947	hsa-miR-4694-3p	CLIP-seq
MIRT2507948	hsa-miR-4802-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT2507949	hsa-miR-522	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT2507950	hsa-miR-765	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT2507946	hsa-miR-3928	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT2507947	hsa-miR-4694-3p	CLIP-seq
MIRT2507948	hsa-miR-4802-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT2507949	hsa-miR-522	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT2507950	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
YY1	Activation	9092564

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004129	Function	Cytochrome-c oxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	31536960, 32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005751	Component	Mitochondrial respiratory chain complex IV	IDA	31536960
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2155413
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IBA	21873635
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 603774
• HGNC: 2292
• e!Ensembl: ENSG00000127184

Protein

• UniProt ID: P15954
• Protein name: Cytochrome c oxidase subunit 7C, mitochondrial (Cytochrome c oxidase polypeptide VIIc)
• Protein function: Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu
• PDB: 5Z62
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02935	COX7C	1 → 62	Cytochrome c oxidase subunit VIIc	Family

• Sequence:

  MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
  LKT

• Sequence length: 63

Pathways

KEGG:

Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Reactome:

TP53 Regulates Metabolic Genes
Respiratory electron transport

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	20882379