ADORA1 (adenosine A1 receptor)

Gene

• Entrez ID: 134
• Gene name: Adenosine A1 receptor
• Gene symbol: ADORA1
• Synonyms: RDC7
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: The protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT769574	hsa-miR-1205	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT769577	hsa-miR-1909	CLIP-seq
MIRT769578	hsa-miR-1915	CLIP-seq
MIRT769579	hsa-miR-1976	CLIP-seq
MIRT769580	hsa-miR-3202	CLIP-seq
MIRT769581	hsa-miR-3918	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT769583	hsa-miR-4650-5p	CLIP-seq
MIRT769584	hsa-miR-4661-3p	CLIP-seq
MIRT769585	hsa-miR-4726-3p	CLIP-seq
MIRT769586	hsa-miR-4747-5p	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT1927025	hsa-miR-1266	CLIP-seq
MIRT769578	hsa-miR-1915	CLIP-seq
MIRT1927026	hsa-miR-24	CLIP-seq
MIRT1927027	hsa-miR-4514	CLIP-seq
MIRT1927028	hsa-miR-4518	CLIP-seq
MIRT1927029	hsa-miR-4645-5p	CLIP-seq
MIRT1927030	hsa-miR-4673	CLIP-seq
MIRT1927031	hsa-miR-4692	CLIP-seq
MIRT1927032	hsa-miR-4717-3p	CLIP-seq
MIRT769585	hsa-miR-4726-3p	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT1927033	hsa-miR-940	CLIP-seq
MIRT2167878	hsa-miR-1184	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT2167879	hsa-miR-1273f	CLIP-seq
MIRT2167880	hsa-miR-136	CLIP-seq
MIRT2167881	hsa-miR-141	CLIP-seq
MIRT2167882	hsa-miR-15a	CLIP-seq
MIRT2167883	hsa-miR-15b	CLIP-seq
MIRT2167884	hsa-miR-16	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT2167885	hsa-miR-195	CLIP-seq
MIRT2167886	hsa-miR-1972	CLIP-seq
MIRT2167887	hsa-miR-200a	CLIP-seq
MIRT2167888	hsa-miR-2117	CLIP-seq
MIRT2167889	hsa-miR-22	CLIP-seq
MIRT1927026	hsa-miR-24	CLIP-seq
MIRT2167890	hsa-miR-3176	CLIP-seq
MIRT2167891	hsa-miR-3183	CLIP-seq
MIRT2167892	hsa-miR-3665	CLIP-seq
MIRT2167893	hsa-miR-3922-3p	CLIP-seq
MIRT2167894	hsa-miR-424	CLIP-seq
MIRT2167895	hsa-miR-4255	CLIP-seq
MIRT2167896	hsa-miR-4269	CLIP-seq
MIRT2167897	hsa-miR-4273	CLIP-seq
MIRT2167898	hsa-miR-4279	CLIP-seq
MIRT2167899	hsa-miR-4283	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT2167900	hsa-miR-4435	CLIP-seq
MIRT2167901	hsa-miR-4437	CLIP-seq
MIRT2167902	hsa-miR-4447	CLIP-seq
MIRT2167903	hsa-miR-4472	CLIP-seq
MIRT2167904	hsa-miR-4488	CLIP-seq
MIRT1927027	hsa-miR-4514	CLIP-seq
MIRT769583	hsa-miR-4650-5p	CLIP-seq
MIRT1927031	hsa-miR-4692	CLIP-seq
MIRT2167905	hsa-miR-4697-5p	CLIP-seq
MIRT2167906	hsa-miR-4723-3p	CLIP-seq
MIRT2167907	hsa-miR-4736	CLIP-seq
MIRT2167908	hsa-miR-4742-5p	CLIP-seq
MIRT2167909	hsa-miR-4756-3p	CLIP-seq
MIRT2167910	hsa-miR-497	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT2167911	hsa-miR-615-5p	CLIP-seq
MIRT2167912	hsa-miR-922	CLIP-seq
MIRT1927033	hsa-miR-940	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT2167881	hsa-miR-141	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT2167887	hsa-miR-200a	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	9547356
RELA	Activation	9547356

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000186	Process	Activation of MAPKK activity	IEA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001883	Function	Purine nucleoside binding	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IEA
GO:0002674	Process	Negative regulation of acute inflammatory response	IEA
GO:0002686	Process	Negative regulation of leukocyte migration	IEA
GO:0002793	Process	Positive regulation of peptide secretion	IEA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0003093	Process	Regulation of glomerular filtration	IEA
GO:0005515	Function	Protein binding	IPI	16481441, 23291003, 28298427
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IDA	27134041
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	1530647
GO:0006612	Process	Protein targeting to membrane	IEA
GO:0006909	Process	Phagocytosis	TAS	8360491
GO:0006954	Process	Inflammatory response	TAS	8360491
GO:0007165	Process	Signal transduction	TAS	1530647
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	7818494
GO:0007399	Process	Nervous system development	TAS	8450977
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030673	Component	Axolemma	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0032244	Process	Positive regulation of nucleoside transport	IEA
GO:0032795	Function	Heterotrimeric G-protein binding	IEA
GO:0032900	Process	Negative regulation of neurotrophin production	IEA
GO:0035307	Process	Positive regulation of protein dephosphorylation	IEA
GO:0035814	Process	Negative regulation of renal sodium excretion	IEA
GO:0042323	Process	Negative regulation of circadian sleep/wake cycle, non-REM sleep	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043268	Process	Positive regulation of potassium ion transport	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0045741	Process	Positive regulation of epidermal growth factor-activated receptor activity	IEA
GO:0045822	Process	Negative regulation of heart contraction	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0050890	Process	Cognition	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IEA
GO:0050996	Process	Positive regulation of lipid catabolic process	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060087	Process	Relaxation of vascular associated smooth muscle	IEA
GO:0070256	Process	Negative regulation of mucus secretion	IEA
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IEA
GO:0097190	Process	Apoptotic signaling pathway	TAS	7818494
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:0099582	Function	Neurotransmitter receptor activity involved in regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900453	Process	Negative regulation of long-term synaptic depression	IEA
GO:1901216	Process	Positive regulation of neuron death	IEA

Other IDs

• MIM: 102775
• HGNC: 262
• e!Ensembl: ENSG00000163485

Protein

• UniProt ID: P30542
• Protein name: Adenosine receptor A1
• Protein function: Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
• PDB: 5N2S, 5UEN, 6D9H, 7LD3, 7LD4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	26 → 288	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
  LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
  PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
  VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
  FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
  KIWNDHFRCQPAPPIDEDLPEERPDD

• Sequence length: 326

Pathways

KEGG:

cGMP-PKG signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes
Renin secretion
Morphine addiction

Reactome:

Adenosine P1 receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma, Childhood asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	30929738, 31619474, 27182965, 31036433, 30929738
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs1801155, rs121908380, rs121908702, rs267606674, rs4939827, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553149467, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	12160945
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19820430

Unknown
Disease name	Disease term	dbSNP ID	References
Cerebral infraction	Infarction, Middle Cerebral Artery		23437309
Catalepsy	Catalepsy		9407998
Cerebral ischemia	Brain Stem Ischemia, Transient, Transient Cerebral Ischemia		23437309
Cerebral thrombosis	Middle Cerebral Artery Thrombosis		23437309
Respiratory tract diseases	Respiratory Tract Diseases		30595370
Subarachnoid hemorrhage	Subarachnoid Hemorrhage		18950269
Transient ischemic attack	Transient Ischemic Attack, Posterior Circulation Transient Ischemic Attack, Carotid Circulation Transient Ischemic Attack, Transient Ischemic Attack, Vertebrobasilar Circulation, Crescendo Transient Ischemic Attacks, Transient Ischemic Attack, Anterior Circulation		23437309