ZFAND2B (zinc finger AN1-type containing 2B)

Gene

• Entrez ID: 130617
• Gene name: Zinc finger AN1-type containing 2B
• Gene symbol: ZFAND2B
• Synonyms: AIRAPL
• Chromosome: 2
• Chromosome location: 2q35
• Summary: This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT487003	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT487002	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT487001	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT487000	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT486999	hsa-miR-181a-2-3p	PAR-CLIP	23592263
MIRT486997	hsa-miR-1273g-3p	PAR-CLIP	23592263
MIRT486998	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT486996	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT486995	hsa-miR-4721	PAR-CLIP	23592263
MIRT486994	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT486993	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT486992	hsa-miR-6509-3p	PAR-CLIP	23592263
MIRT486991	hsa-miR-1226-5p	PAR-CLIP	23592263
MIRT487003	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT487002	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT487001	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT487000	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT486999	hsa-miR-181a-2-3p	PAR-CLIP	23592263
MIRT486997	hsa-miR-1273g-3p	PAR-CLIP	23592263
MIRT486998	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT486996	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT486995	hsa-miR-4721	PAR-CLIP	23592263
MIRT486994	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT486993	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT486992	hsa-miR-6509-3p	PAR-CLIP	23592263
MIRT486991	hsa-miR-1226-5p	PAR-CLIP	23592263
MIRT1509439	hsa-miR-3074-5p	CLIP-seq
MIRT1509440	hsa-miR-3127-3p	CLIP-seq
MIRT1509441	hsa-miR-3180-5p	CLIP-seq
MIRT1509442	hsa-miR-3667-3p	CLIP-seq
MIRT1509443	hsa-miR-4645-5p	CLIP-seq
MIRT1509444	hsa-miR-4673	CLIP-seq
MIRT1509445	hsa-miR-4722-3p	CLIP-seq
MIRT1509441	hsa-miR-3180-5p	CLIP-seq
MIRT2373721	hsa-miR-3922-5p	CLIP-seq
MIRT2373722	hsa-miR-451b	CLIP-seq
MIRT2373723	hsa-miR-4685-5p	CLIP-seq
MIRT2373724	hsa-miR-4708-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	26876100
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 25416956, 26876100, 31515488, 32296183
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006616	Process	SRP-dependent cotranslational protein targeting to membrane, translocation	IMP	24160817
GO:0008270	Function	Zinc ion binding	IEA
GO:0031225	Component	Anchored component of membrane	ISS
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IDA	26876100
GO:0043130	Function	Ubiquitin binding	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	26692333
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	ISS
GO:0045047	Process	Protein targeting to ER	IMP	26692333

Other IDs

• MIM: 613474
• HGNC: 25206
• e!Ensembl: ENSG00000158552

Protein

• UniProt ID: Q8WV99
• Protein name: AN1-type zinc finger protein 2B (Arsenite-inducible RNA-associated protein-like protein) (AIRAP-like protein)
• Protein function: Plays a role in protein homeostasis by regulating both the translocation and the ubiquitin-mediated proteasomal degradation of nascent proteins at the endoplasmic reticulum. It is involved in the regulation of signal-mediated translocation of pr
• PDB: 1X4V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01428	zf-AN1	10 → 49	AN1-like Zinc finger	Family
  PF01428	zf-AN1	100 → 139	AN1-like Zinc finger	Family

• Sequence:

  MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
  NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSR
  NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTR
  SPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQ
  RQQAQSRSSKPSNCSLC

• Sequence length: 257

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	26198764