GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

CNR1 (cannabinoid receptor 1)

Gene

1268

Cannabinoid receptor 1

CNR1

CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR

6q15

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protei

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT755408	hsa-miR-212-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35978628
MIRT901338	hsa-miR-1183	CLIP-seq
MIRT901339	hsa-miR-1225-5p	CLIP-seq
MIRT901340	hsa-miR-132	CLIP-seq
MIRT901341	hsa-miR-194	CLIP-seq
MIRT901342	hsa-miR-212	CLIP-seq
MIRT901343	hsa-miR-214	CLIP-seq
MIRT901344	hsa-miR-29a	CLIP-seq
MIRT901345	hsa-miR-29b	CLIP-seq
MIRT901346	hsa-miR-29c	CLIP-seq
MIRT901347	hsa-miR-3155	CLIP-seq
MIRT901348	hsa-miR-3155b	CLIP-seq
MIRT901349	hsa-miR-323-3p	CLIP-seq
MIRT901350	hsa-miR-3591-5p	CLIP-seq
MIRT901351	hsa-miR-3619-5p	CLIP-seq
MIRT901352	hsa-miR-425	CLIP-seq
MIRT901353	hsa-miR-4473	CLIP-seq
MIRT901354	hsa-miR-4475	CLIP-seq
MIRT901355	hsa-miR-4514	CLIP-seq
MIRT901356	hsa-miR-4522	CLIP-seq
MIRT901357	hsa-miR-4530	CLIP-seq
MIRT901358	hsa-miR-4643	CLIP-seq
MIRT901359	hsa-miR-4671-3p	CLIP-seq
MIRT901360	hsa-miR-4690-5p	CLIP-seq
MIRT901361	hsa-miR-4692	CLIP-seq
MIRT901362	hsa-miR-4693-5p	CLIP-seq
MIRT901363	hsa-miR-4712-5p	CLIP-seq
MIRT901364	hsa-miR-4714-5p	CLIP-seq
MIRT901365	hsa-miR-484	CLIP-seq
MIRT901366	hsa-miR-512-3p	CLIP-seq
MIRT901367	hsa-miR-516a-5p	CLIP-seq
MIRT901368	hsa-miR-520f	CLIP-seq
MIRT901369	hsa-miR-626	CLIP-seq
MIRT901370	hsa-miR-761	CLIP-seq
MIRT901371	hsa-miR-770-5p	CLIP-seq
MIRT901372	hsa-miR-1178	CLIP-seq
MIRT901373	hsa-miR-1279	CLIP-seq
MIRT901374	hsa-miR-134	CLIP-seq
MIRT901375	hsa-miR-1343	CLIP-seq
MIRT901376	hsa-miR-137	CLIP-seq
MIRT901377	hsa-miR-141	CLIP-seq
MIRT901378	hsa-miR-200a	CLIP-seq
MIRT901379	hsa-miR-216a	CLIP-seq
MIRT901380	hsa-miR-216b	CLIP-seq
MIRT901381	hsa-miR-3074-5p	CLIP-seq
MIRT901382	hsa-miR-3118	CLIP-seq
MIRT901383	hsa-miR-3124-3p	CLIP-seq
MIRT901384	hsa-miR-3128	CLIP-seq
MIRT901385	hsa-miR-3136-5p	CLIP-seq
MIRT901350	hsa-miR-3591-5p	CLIP-seq
MIRT901386	hsa-miR-3606	CLIP-seq
MIRT901387	hsa-miR-374c	CLIP-seq
MIRT901388	hsa-miR-4265	CLIP-seq
MIRT901389	hsa-miR-4296	CLIP-seq
MIRT901390	hsa-miR-4318	CLIP-seq
MIRT901391	hsa-miR-4322	CLIP-seq
MIRT901392	hsa-miR-4417	CLIP-seq
MIRT901393	hsa-miR-4439	CLIP-seq
MIRT901394	hsa-miR-4513	CLIP-seq
MIRT901395	hsa-miR-4659a-3p	CLIP-seq
MIRT901396	hsa-miR-4659b-3p	CLIP-seq
MIRT901362	hsa-miR-4693-5p	CLIP-seq
MIRT901397	hsa-miR-4778-3p	CLIP-seq
MIRT901398	hsa-miR-578	CLIP-seq
MIRT901399	hsa-miR-643	CLIP-seq
MIRT901400	hsa-miR-655	CLIP-seq
MIRT901401	hsa-miR-892a	CLIP-seq
MIRT901402	hsa-miR-921	CLIP-seq
MIRT901381	hsa-miR-3074-5p	CLIP-seq
MIRT1967395	hsa-miR-377	CLIP-seq
MIRT2203017	hsa-miR-4700-3p	CLIP-seq
MIRT2203018	hsa-let-7a	CLIP-seq
MIRT2203019	hsa-let-7b	CLIP-seq
MIRT2203020	hsa-let-7c	CLIP-seq
MIRT2203021	hsa-let-7d	CLIP-seq
MIRT2203022	hsa-let-7e	CLIP-seq
MIRT2203023	hsa-let-7f	CLIP-seq
MIRT2203024	hsa-let-7g	CLIP-seq
MIRT2203025	hsa-let-7i	CLIP-seq
MIRT2203026	hsa-miR-1229	CLIP-seq
MIRT2203027	hsa-miR-128	CLIP-seq
MIRT2203028	hsa-miR-151-3p	CLIP-seq
MIRT901341	hsa-miR-194	CLIP-seq
MIRT2203029	hsa-miR-202	CLIP-seq
MIRT2203030	hsa-miR-2116	CLIP-seq
MIRT2203031	hsa-miR-27a	CLIP-seq
MIRT2203032	hsa-miR-27b	CLIP-seq
MIRT2203033	hsa-miR-3187-3p	CLIP-seq
MIRT901349	hsa-miR-323-3p	CLIP-seq
MIRT2203034	hsa-miR-4257	CLIP-seq
MIRT2203035	hsa-miR-4328	CLIP-seq
MIRT2203036	hsa-miR-4435	CLIP-seq
MIRT2203037	hsa-miR-4458	CLIP-seq
MIRT2203038	hsa-miR-4500	CLIP-seq
MIRT901358	hsa-miR-4643	CLIP-seq
MIRT2203039	hsa-miR-4645-5p	CLIP-seq
MIRT901395	hsa-miR-4659a-3p	CLIP-seq
MIRT901396	hsa-miR-4659b-3p	CLIP-seq
MIRT2203040	hsa-miR-4673	CLIP-seq
MIRT2203017	hsa-miR-4700-3p	CLIP-seq
MIRT2203041	hsa-miR-4701-5p	CLIP-seq
MIRT901397	hsa-miR-4778-3p	CLIP-seq
MIRT2203042	hsa-miR-548s	CLIP-seq
MIRT901398	hsa-miR-578	CLIP-seq
MIRT2203043	hsa-miR-588	CLIP-seq
MIRT2203044	hsa-miR-617	CLIP-seq
MIRT2203045	hsa-miR-653	CLIP-seq
MIRT2203046	hsa-miR-890	CLIP-seq
MIRT2203047	hsa-miR-98	CLIP-seq
MIRT2386297	hsa-miR-1289	CLIP-seq
MIRT2386298	hsa-miR-3198	CLIP-seq
MIRT2386299	hsa-miR-4294	CLIP-seq
MIRT2386300	hsa-miR-4309	CLIP-seq
MIRT2386301	hsa-miR-4790-3p	CLIP-seq
MIRT2505992	hsa-miR-3115	CLIP-seq
MIRT2505993	hsa-miR-4735-5p	CLIP-seq
MIRT2505994	hsa-miR-4777-5p	CLIP-seq
MIRT2505995	hsa-miR-518d-5p	CLIP-seq
MIRT2505996	hsa-miR-519b-5p	CLIP-seq
MIRT2505997	hsa-miR-519c-5p	CLIP-seq
MIRT2505998	hsa-miR-520c-5p	CLIP-seq
MIRT2505999	hsa-miR-526a	CLIP-seq
MIRT2506000	hsa-miR-944	CLIP-seq
MIRT2505994	hsa-miR-4777-5p	CLIP-seq
MIRT2505995	hsa-miR-518d-5p	CLIP-seq
MIRT2505996	hsa-miR-519b-5p	CLIP-seq
MIRT2505997	hsa-miR-519c-5p	CLIP-seq
MIRT2505998	hsa-miR-520c-5p	CLIP-seq
MIRT2505999	hsa-miR-526a	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT6	Activation	18156315

Show/Hide all(60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002866	Process	Positive regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004949	Function	Cannabinoid receptor activity	IBA	21873635
GO:0004949	Function	Cannabinoid receptor activity	IDA	18761332
GO:0005515	Function	Protein binding	IPI	17356572, 17895407, 20590567, 23296780, 26158621, 28102227, 28734930, 28843453, 29870711, 30073165
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	17895407
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	1718258
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1718258
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	18761332
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007283	Process	Spermatogenesis	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007568	Process	Aging	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007613	Process	Memory	IEA
GO:0008144	Function	Drug binding	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014063	Process	Negative regulation of serotonin secretion	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0019222	Process	Regulation of metabolic process	IBA	21873635
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031622	Process	Positive regulation of fever generation	IEA
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032592	Component	Integral component of mitochondrial membrane	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IEA
GO:0033602	Process	Negative regulation of dopamine secretion	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0038171	Process	Cannabinoid signaling pathway	IBA	21873635
GO:0038171	Process	Cannabinoid signaling pathway	IDA	17895407
GO:0042220	Process	Response to cocaine	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IPI	20590567, 28734930
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045759	Process	Negative regulation of action potential	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0051001	Process	Negative regulation of nitric-oxide synthase activity	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060405	Process	Regulation of penile erection	IEA
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA
GO:0099635	Function	Voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels	IEA
GO:0099703	Process	Induction of synaptic vesicle exocytosis by positive regulation of presynaptic cytosolic calcium ion concentration	IEA

MIM	HGNC	e!Ensembl
114610	2159	ENSG00000118432

Protein

UniProt ID

P21554

Protein name

Cannabinoid receptor 1 (CB-R) (CB1) (CANN6)

Protein function

G-protein coupled receptor for endogenous cannabinoids (eCBs), including N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG), as well as phytocannabinoids, such as delta(9)-tetrahydrocannabinol (THC) (Pub

PDB

1LVQ , 1LVR , 2B0Y , 2KOE , 2MZ2 , 2MZ3 , 2MZA , 5TGZ , 5U09 , 5XR8 , 5XRA , 6KPG , 6KQI , 6N4B , 7FEE , 7V3Z , 7WV9 , 8GAG , 8GHV , 8IKG , 8IKH , 8K8J , 8WRZ , 8WU1 , 9B54 , 9B65 , 9B9Y , 9B9Z , 9BA0 , 9ERX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	133 → 397	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Sequence length

472

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Neuroactive ligand-receptor interaction Thermogenesis Retrograde endocannabinoid signaling		Class A/1 (Rhodopsin-like receptors) G alpha (i) signalling events

Associated diseases

Show/Hide Causal Diseases (9)

Causal
Disease name	Disease term	dbSNP ID	References
Attention deficit hyperactivity disorder	Attention Deficit Disorder, Attention deficit hyperactivity disorder	rs120074176, rs786205019	22034972
Epilepsy	Epilepsy, Temporal Lobe, Uncinate Epilepsy, Epilepsy, Benign Psychomotor, Childhood, Epilepsy, Lateral Temporal	rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	20498848
Melanoma	Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	28131817
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	12876144
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	18722357
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431, rs200612497	16818650
Rhabdomyosarcoma	Rhabdomyosarcoma	rs137854557, rs121909224, rs63751466, rs11540652, rs28934874, rs104894229, rs104894230, rs267606708, rs80357867, rs276174889, rs80359011, rs80358556, rs80359391, rs80357989, rs886037650, rs886037651, rs201744589, rs587780067, rs587781462, rs587782144, rs55863639, rs768638173, rs864622639, rs875989784, rs876657714, rs878855246, rs199474742, rs879253942, rs886037721, rs1057519989, rs750380279, rs1131691211, rs1202793339, rs1567611375	19509271
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21513772
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	12954810

Show/Hide Unknown Diseases (22)

Unknown
Disease name	Disease term	dbSNP ID	References
Akinetic-rigid variant of huntington disease	Akinetic-Rigid Variant of Huntington Disease		20929960
Anxiety disorder	Anxiety Disorders, Anxiety States, Neurotic		15081793, 18690112
Bipolar disorder	Bipolar Disorder		20080186, 24126189
Catalepsy	Catalepsy		10318961
Clonic seizures	Clonic Seizures		12954810
Endometrioma	Endometrioma		20864642
Endometriosis	Endometriosis	rs1800629, rs1143634	20864642
Grand mal status epilepticus	Grand Mal Status Epilepticus		19368833
Huntington disease	Huntington Disease, Huntington Disease, Late Onset, Juvenile Huntington Disease	rs768047421	20929960
Hypotonic seizures	Epileptic drop attack		12954810
Jacksonian seizure	Jacksonian Seizure		12954810
Liver cirrhosis	Liver Cirrhosis		21863215, 11433348
Liver fibrosis	Fibrosis, Liver		21863215, 11433348
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	23269207, 22826533, 24180398, 24035826, 25371528, 24035826, 25371528, 22826533, 23269207, 24180398, 23407780, 22534181, 20080186, 18579347
Minimal brain dysfunction	Minimal Brain Dysfunction		22034972
Movement disorders	Movement Disorders		10802025
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		19368833
Pancreatic neoplasm	Pancreatic Neoplasm		16818650
Pancreatitis	Pancreatitis	rs61734659	17484889
Petit mal status	Petit mal status		19368833
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		19368833
Status marmoratus	Etat Marbre		10802025

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412