CCR7 (C-C motif chemokine receptor 7)

Gene

• Entrez ID: 1236
• Gene name: C-C motif chemokine receptor 7
• Gene symbol: CCR7
• Synonyms: BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expres

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006813	hsa-let-7a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22251626
MIRT018216	hsa-miR-335-5p	Microarray	18185580
MIRT440980	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT440980	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT732313	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	27814720
MIRT732313	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	27814720
MIRT732697	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	33630421
MIRT732697	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	33630421
MIRT440980	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31813289
MIRT873274	hsa-miR-1207-3p	CLIP-seq
MIRT873275	hsa-miR-1271	CLIP-seq
MIRT873276	hsa-miR-129-5p	CLIP-seq
MIRT873277	hsa-miR-146b-3p	CLIP-seq
MIRT873278	hsa-miR-182	CLIP-seq
MIRT873279	hsa-miR-1827	CLIP-seq
MIRT873280	hsa-miR-3176	CLIP-seq
MIRT873281	hsa-miR-3185	CLIP-seq
MIRT873282	hsa-miR-3186-3p	CLIP-seq
MIRT873283	hsa-miR-339-5p	CLIP-seq
MIRT873284	hsa-miR-3612	CLIP-seq
MIRT873285	hsa-miR-361-5p	CLIP-seq
MIRT873286	hsa-miR-3922-3p	CLIP-seq
MIRT873287	hsa-miR-432	CLIP-seq
MIRT873288	hsa-miR-4421	CLIP-seq
MIRT873289	hsa-miR-4443	CLIP-seq
MIRT873290	hsa-miR-4690-3p	CLIP-seq
MIRT873291	hsa-miR-511	CLIP-seq
MIRT873292	hsa-miR-650	CLIP-seq
MIRT873293	hsa-miR-658	CLIP-seq
MIRT873294	hsa-miR-765	CLIP-seq
MIRT873295	hsa-miR-96	CLIP-seq
MIRT873281	hsa-miR-3185	CLIP-seq
MIRT873287	hsa-miR-432	CLIP-seq
MIRT873289	hsa-miR-4443	CLIP-seq
MIRT2196043	hsa-miR-548ad	CLIP-seq
MIRT873294	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EPAS1	Activation	19305150
HIF1A	Activation	17178876;19305150
KLF2	Unknown	20146713
NFKB1	Activation	11830455;19164127
NFKB1	Unknown	22158872
RELA	Activation	11830455;19164127
RELA	Unknown	22158872
TRERF1	Unknown	17006331

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IC	12729902
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IC	15569314
GO:0002407	Process	Dendritic cell chemotaxis	IC	15778365
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IC	14592837
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IDA	11602640
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0002885	Process	Positive regulation of hypersensitivity	ISS
GO:0002922	Process	Positive regulation of humoral immune response	ISS
GO:0004930	Function	G protein-coupled receptor activity	TAS	16621978
GO:0005739	Component	Mitochondrion	IDA
GO:0005886	Component	Plasma membrane	IDA	21051556
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	16621978
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	IDA	18308860
GO:0016021	Component	Integral component of membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA	21873635
GO:0016493	Function	C-C chemokine receptor activity	ISS
GO:0019722	Process	Calcium-mediated signaling	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IBA	21873635
GO:0030838	Process	Positive regulation of actin filament polymerization	IC	11242036
GO:0031274	Process	Positive regulation of pseudopodium assembly	IC	11242036
GO:0031529	Process	Ruffle organization	IC	15569314
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032649	Process	Regulation of interferon-gamma production	ISS
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032695	Process	Negative regulation of interleukin-12 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0034695	Process	Response to prostaglandin E	IC	14592837
GO:0035757	Function	Chemokine (C-C motif) ligand 19 binding	IBA	21873635
GO:0035757	Function	Chemokine (C-C motif) ligand 19 binding	IPI	9507024
GO:0035758	Function	Chemokine (C-C motif) ligand 21 binding	IBA	21873635
GO:0035758	Function	Chemokine (C-C motif) ligand 21 binding	IPI	9507024
GO:0038115	Process	Chemokine (C-C motif) ligand 19 signaling pathway	IEA
GO:0038116	Process	Chemokine (C-C motif) ligand 21 signaling pathway	IEA
GO:0038117	Function	C-C motif chemokine 19 receptor activity	IBA	21873635
GO:0038117	Function	C-C motif chemokine 19 receptor activity	IDA	9507024
GO:0038121	Function	C-C motif chemokine 21 receptor activity	IDA	9507024
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IC	15059845
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IC	15059845, 15778365
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IC	15569314
GO:0045860	Process	Positive regulation of protein kinase activity	IC	14592837, 15059845
GO:0046330	Process	Positive regulation of JNK cascade	IC	15778365
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IC	14592837
GO:0051491	Process	Positive regulation of filopodium assembly	IC	15569314
GO:0051897	Process	Positive regulation of protein kinase B signaling	IC	15059845, 15778365
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IC	12729902, 15778365
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	11602640
GO:0071731	Process	Response to nitric oxide	IC	16249377
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0090630	Process	Activation of GTPase activity	IC	15778365
GO:0097022	Process	Lymphocyte migration into lymph node	TAS	18379575
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:2000147	Process	Positive regulation of cell motility	IC	15778365
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	ISS
GO:2000522	Process	Positive regulation of immunological synapse formation	ISS
GO:2000525	Process	Positive regulation of T cell costimulation	ISS
GO:2000526	Process	Positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	ISS
GO:2000547	Process	Regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IC	15059845

Other IDs

• MIM: 600242
• HGNC: 1608
• e!Ensembl: ENSG00000126353

Protein

• UniProt ID: P32248
• Protein name: C-C chemokine receptor type 7 (C-C CKR-7) (CC-CKR-7) (CCR-7) (BLR2) (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor) (CD antigen CD197)
• Protein function: Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
• PDB: 6QZH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	75 → 326	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
  LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
  SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
  GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
  FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
  SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
  IRRSSMSVEAETTTTFSP

• Sequence length: 378

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Anhedonia	Anhedonia		24333375
Grand mal status epilepticus	Grand Mal Status Epilepticus		17181556
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		17181556
Petit mal status	Petit mal status		17181556
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		17181556
T-cell lymphoma/leukemia	Adult T-Cell Lymphoma/Leukemia		26437031