CCR3 (C-C motif chemokine receptor 3)

Gene

• Entrez ID: 1232
• Gene name: C-C motif chemokine receptor 3
• Gene symbol: CCR3
• Synonyms: C C CKR3, CC-CKR-3, CD193, CKR 3, CKR3, CMKBR3
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. Alternatively spliced transcript variants have been described. [provided by RefSeq, Sep 2009]

Transcription factors

Transcription factor	Regulation	Reference
GATA1	Unknown	22217447
NFKB1	Activation	16604092
RELA	Activation	16604092

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10415069
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9302298
GO:0006935	Process	Chemotaxis	TAS	10201960
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	IBA	21873635
GO:0006968	Process	Cellular defense response	TAS	10713092
GO:0007155	Process	Cell adhesion	TAS	10201960
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10201960
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016032	Process	Viral process	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA	21873635
GO:0019722	Process	Calcium-mediated signaling	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IDA	11425309
GO:0045766	Process	Positive regulation of angiogenesis	IMP	19525930
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

Other IDs

• MIM: 601268
• HGNC: 1604
• e!Ensembl: ENSG00000183625

Protein

• UniProt ID: P51677
• Protein name: C-C chemokine receptor type 3 (C C CKR3) (C-C CKR-3) (CC-CKR-3) (CCR-3) (CCR3) (CKR 3) (CKR3) (Eosinophil eotaxin receptor) (CD antigen CD193)
• Protein function: Receptor for C-C type chemokine. Binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5) and CCL15 (PubMed:7622448, PubMed:8642344, PubMed:8676064). Subsequently transduces a signal by increasing the intracellular calcium ions level (PubMed:8676064). In addition acts as a possible functional receptor for NARS1 (PubMed:30171954). ; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 301	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
  KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
  IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
  TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
  IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
  YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

• Sequence length: 355

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Human cytomegalovirus infection
Kaposi sarcoma-associated herpesvirus infection
Viral carcinogenesis

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autoimmune diseases	Autoimmune Diseases	rs41285370, rs869025224	21383967
Asthma	Asthma, Asthma, Aspirin-Induced	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	21150878, 20485159
Rheumatoid arthritis	Rheumatoid Arthritis, Rheumatoid Arthritis, Systemic Juvenile	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963	26546613, 23603761
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	16314464
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs-1, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	22190364
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	18249437
Arthritis	Systemic onset juvenile chronic arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	23603761
Behcet syndrome	Behcet Syndrome	rs886040969, rs886039866, rs746055479, rs752615209, rs774164456, rs751454741	23291587

Unknown
Disease name	Disease term	dbSNP ID	References
Celiac disease	Celiac Disease	rs2305764, rs35218876	22057235, 20190752, 26546613, 24999842
Alveolitis	Alveolitis, Fibrosing		16314464
Eczema	Eczema, Infantile		18249437
Grand mal status epilepticus	Grand Mal Status Epilepticus		19490431
Immune system diseases	Immune System Diseases		21383967
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		19490431
Oligoarticular arthritis	Oligoarticular Juvenile Idiopathic Arthritis		23603761
Pauciarticular chronic arthritis	Juvenile pauciarticular chronic arthritis		23603761
Petit mal status	Petit mal status		19490431
Seronegative polyarthritis	Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative		23603761
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		19490431
Still disease	Juvenile-Onset Still Disease		23603761